<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28695

Description Mediator of RNA polymerase II transcription subunit 13
SequenceMLSSRVIHPESKKPSVCYSSISCCSILYTCTYAIFRRRILDIYIHKLVLIAATDALALGIMETIHPKNVLTNYYKIGHINEVEIYVYGTKTKKSDQYLLELELEIRNTYPKVLVTYYNKFLFQFHFCFLETKVDLSTLYPDLYQESFFKVKTDVLANPNKPGYLPYYNVSFLKATKKLFLYSLSKSNKLKLFGNHAITKKNDGTYRILQIDPILLTNGDIYISVFEKLNPYFFDSVLIPADELIRSDLTYIIYLIPSGIRCHLYSSEDISSCFTKEAPDHSTDLLELIKKSTGIDLCEERELLWVKLIPNLQHLNNQTSKIAQFIHTVTNKKTILWPWCLCVLQYGFCEEEIGKDDVNDKLSDPLNVIADFIELNIEYKNSNNTLDQNNNTHMNANLSDPSFLSTGLSSVGPYNDLKSDSNLEEYIQPNETHRNHVPSPLSSAAVTNSSKSENQQKEQDEETDEINDLFGDASDGSDAEMSSLADQNAQEKIDTKSDINSDDNRELDESLAAYQLEKNEKEDRNMESGSTVDRESQNKGTFIDIPKDQMTIISAKPMKLQSPRIYSDPGAPLPMDPTPIIPQGSFAFGGNTSNVFPGSNNNTSESEEPKSRSIFSPIPFNPIIKSNIDTKYGKGGKFYVEKETTMDSDSRRNALRATSISGNDLALVEDSMKGLEQPLNRTTQEDTIMPSAKRFSQSKPSFSADELLGKETFKRQIAPDNDGESTSAHAIGFNDEVIQGEGDDHPEADSSEDADEEEEEEEEEEESDEDDDMTQDNVFSKSSYALKLNTFNGPQNGTVNTGNGGQEGIHQQDQEQVNQGLLRFSNINEGSIVNKNLKTSTISPSNTGNYSGNSENVLLSPQEMEQDNMQDSLGTQGPVSLDENIERTMDSTFMKKEPTEKGEGTPKTSSVSESSNCLPLILRNVNINTIPERYILNNLSQKSVLNSKSEFSMELEERDEKSDFELRRGNEMRVSISNIDLFLTNIISNLIFDDSVNDYFQNMRLNNPTQEKRYSTKCYNCKTPDEDVEKKLFDVFPFMLRSRLNEFMREESNGSIFDDDAESRDPMNNEIDFLGDIADESLLHPNSQEKEPKSLEWICFSEKEESNSLGFNSYVKAMKEHPDTTCDKASEEQNLFQLCFNKIKIISASEKEINLNSISLRFWKYLNFKPLHGPKNFQLLLVSEQRHGVYRDELTGFLNSLIYNYKNSNFGEITKVSLMNINQDAGTSTVNDGVLTSDDQQIYTSNNDYYLKVNKSLDTVAELIKLDLINKSNRFEFDRPLLLLFVNFDKRFNSLVQLSSLCRNFMLFLRKHHVPLVEVFSHIIPFEEIIHEVKGFRRLKYLSSYNLTRLSMNLYNKCPEIISHSKGDIFQPKKLFTQFIKEPPHKLHFKFLDSNNGNIGTEYIDDVFLHFAYERSIDKRWIVGAWSDPLGMVTNVKSWYCKNQKKNDNDIFDLESICDDIWEISSSLFKALNEEMANQMSCFGGKKFLVLTRINSVIPDDELVHWKRLSSKNKDISLIVLSADNKARLLAADDIDKVVANSQHPLIEQNYESPSPEFSKFSGSGYNSNPSTQPSPSNTIGALGTSPPTNSSMHSPYQFLNMPGNYLSPQDLIPSNTGHSAPQSNENSGHMGSEDLILQDLSQIITAFIPKVTLPSCHSPLKYCLKMGYLIKPYQIKPQRDSRSFLTFEVSLLSCSNYWNLDAIMRIILKHYKKLISLGDILCVENNFSSNYRSSTNGLVPWHIAAVSKTLDYLVHVDVEE
Length1760
PositionKinase
OrganismPichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Millerozyma.
Aromaticity0.09
Grand average of hydropathy-0.548
Instability index44.15
Isoelectric point4.98
Molecular weight199922.75
Publications









Function






Annotated function

Component of the SRB8-11 complex. The SRB8-11 complex is a
regulatory module of the Mediator complex which is itself involved in
regulation of basal and activated RNA polymerase II-dependent
transcription. The SRB8-11 complex may be involved in the
transcriptional repression of a subset of genes regulated by Mediator.
It may inhibit the association of the Mediator complex with RNA
polymerase II to form the holoenzyme complex.



GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28695
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.24|      21|     142|     349|     394|       1
---------------------------------------------------------------------------
  360-  385 (30.85/31.54)	KLSDPlnviaDFIELNIEYKNSNNTL
  396-  416 (37.39/28.78)	NLSDP.....SFLSTGLSSVGPYNDL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      76.11|      23|      27|    1085|    1111|       2
---------------------------------------------------------------------------
 1089- 1111 (42.46/32.06)	KEPKSL.EWICFSEKEESN..SLGFN
 1115- 1140 (33.65/14.78)	KAMKEHpDTTCDKASEEQNlfQLCFN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     100.11|      26|      27|      98|     123|       3
---------------------------------------------------------------------------
   56-   81 (21.05/ 9.29)	...LALGIMETiHPKnVLTNYYKiGHINE
   98-  123 (44.63/28.48)	LLELELEIRNT.YPK.VLVTYYN.KFLFQ
  128-  149 (34.43/20.17)	FLETKVDLSTL.YPD.L....YQ.ESFFK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.97|      20|      38|     990|    1011|       4
---------------------------------------------------------------------------
  990- 1011 (32.44/23.08)	IFDdsVNDYFQNMRLNNPTQEK
 1031- 1050 (36.53/19.86)	LFD..VFPFMLRSRLNEFMREE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     202.25|      63|     334|    1159|    1234|       5
---------------------------------------------------------------------------
  785-  847 (106.38/56.06)	LKLNTFNGPQNGTVNTGNGGQEGIHQQDQEQVNQGLL.RFSNINEGSIVNKNL....KTSTISPSNTG
 1165- 1232 (95.87/64.84)	LNFKPLHGPKNFQLLLVSEQRHGVYRDELTGFLNSLIyNYKNSNFGEITKVSLmninQDAGTSTVNDG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      79.88|      27|      27|     467|     493|       6
---------------------------------------------------------------------------
  442-  472 (21.34/ 7.41)	...SAAVTNSSKSENQQKE.......QDeetdeinD.LFGDA
  473-  501 (32.84/15.46)	SDGSDAEMSSLADQNAQEK.......ID....tksD.INSD.
  742-  781 (25.70/10.46)	DDHPEADSSEDADEEEEEEeeeeesdED..ddmtqDnVFSKS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.57|      18|     333|     593|     615|       7
---------------------------------------------------------------------------
  581-  602 (28.56/21.96)	PQGSFAFGgntsNVFPGSNNNT
  608-  629 (26.01/ 8.19)	PKSRSIFSpipfNPIIKSNIDT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.86|      20|      27|     863|     882|       8
---------------------------------------------------------------------------
  863-  882 (34.56/21.38)	MEQDNMQDSLGTQGPVSLDE
  893-  912 (33.31/20.33)	MKKEPTEKGEGTPKTSSVSE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.75|      16|      31|     298|     313|       9
---------------------------------------------------------------------------
  298-  313 (28.69/14.87)	EERELLWVKLIPNLQH
  330-  345 (32.06/17.35)	NKKTILWPWCLCVLQY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      46.62|      14|     340|     719|     732|      11
---------------------------------------------------------------------------
  719-  732 (25.75/16.93)	DNDGESTS..AHAIGF
 1057- 1072 (20.87/12.07)	DDDAESRDpmNNEIDF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.48|      31|      41|     641|     672|      12
---------------------------------------------------------------------------
  641-  672 (45.57/36.59)	KETTMDSDSRRNALRATSISGNDLaLVEDSMK
  683-  713 (51.91/36.97)	QEDTIMPSAKRFSQSKPSFSADEL.LGKETFK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.37|      11|     746|     848|     862|      16
---------------------------------------------------------------------------
  848-  862 (16.40/18.06)	NYSGNsenvLLSPQE
 1600- 1610 (23.97/13.67)	NMPGN....YLSPQD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     115.27|      34|     823|     535|     569|      17
---------------------------------------------------------------------------
  535-  569 (57.78/43.75)	SQNKGTFIDiPKDQMT.IISAKPMKLQSPRIYSDPG
 1362- 1396 (57.49/38.77)	SHSKGDIFQ.PKKLFTqFIKEPPHKLHFKFLDSNNG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.85|      29|    1390|     234|     262|      21
---------------------------------------------------------------------------
  234-  262 (52.37/38.35)	DSVLIPADELIRSDLTYII.YLIP..SGIRCH
 1626- 1657 (44.49/31.29)	NSGHMGSEDLILQDLSQIItAFIPkvTLPSCH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28695 with Med13 domain of Kingdom Fungi
Unable to open file!