<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28693
Description |
Piso0_001398 protein |
Sequence | MSADYWSSSQRTKWQFNRQTLLDYRRKLLILERKMIHSGLIKDYPYVNYDWNMRIYLHNLIVKLGRRLNIRQVVLATAEVYLTRFLTKVSVKEVNVYLLVAACVYASCKIEECPQHIRLIVSEARSLWPEYIPHDTAKLAEFEFYLLEEMNLYLILHHPYRSLLQIQTFLKENYDTYAFVLTDDELQNSWSLISDSYITDLHLLYPPHIIAITVIYITIVLKKNSSSLKSNGNSVSIGADVNEKPQSGAIDSQNDPSAMEIEDLMTLSSSNPQEEPLAQTVSGATQLEVKSLSKIDRDTIRINKFMKFLNHSHINLDEVAESIQDMVNLYVVWNHYNENLVKKSLHRMLTNT |
Length | 352 |
Position | Kinase |
Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Millerozyma.
|
Aromaticity | 0.10 |
Grand average of hydropathy | -0.205 |
Instability index | 47.93 |
Isoelectric point | 6.32 |
Molecular weight | 40969.55 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28693
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.11| 13| 15| 68| 82| 2
---------------------------------------------------------------------------
68- 82 (15.63/16.52) LNirQVVLATAEVYL
86- 98 (20.47/13.18) LT..KVSVKEVNVYL
---------------------------------------------------------------------------
|