Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MVTTTLSNVPGNEPLIAASEQLQGLIESLIELGVLVHDNQGTQQSHTALTMKTNQVVSQLSSITAASFTQQYPIPVDVISYIEDGRNPDVYTREFVEATAKSNARLKGRMLGFRKLRDTLGEKLEKEFPVLKDNIEDIKRRTSPE |
Length | 145 |
Position | Middle |
Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Millerozyma. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.395 |
Instability index | 47.85 |
Isoelectric point | 5.46 |
Molecular weight | 16129.09 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28690 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) YPIPVDVISYIE 2) YTREFV | 72 91 | 83 96 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab