<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28681
Description |
Piso0_004269 protein |
Sequence | MTDRLTQLQICLDQLVEQFNATVNYVNNHSDSALLDDDPMSVTNLAVSAPLPGQAQQNSGSASAMVGGSHNGVTKAPSRAETAANFDNTISELSTDIILKSRQISMLIDSLPGIGVTSESQLDIIDSLSRELEEVEKERVEKIKKKDELTKWCEDLIKDMAAGIAETRQQNV |
Length | 172 |
Position | Middle |
Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Millerozyma.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.360 |
Instability index | 35.60 |
Isoelectric point | 4.49 |
Molecular weight | 18717.73 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28681
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.42| 17| 29| 27| 43| 1
---------------------------------------------------------------------------
27- 43 (30.44/21.94) NNHSDSALLDDDPMSVT
58- 74 (29.98/21.51) NSGSASAMVGGSHNGVT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.34| 14| 25| 91| 104| 2
---------------------------------------------------------------------------
91- 104 (23.24/14.70) SELSTDIILK.SRQI
118- 132 (19.10/11.02) SESQLDIIDSlSREL
---------------------------------------------------------------------------
|