<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28680
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MNINNNANSGLSKADTSQIPVDYLEEIRNRLNQVHLSLRRLADQISHNRQINKSKIPNYSHIQNQLQVLLTQLHSISNNLDNNGNILKNSNVYPLPNFPTTQQEGLLTTLLRKKPLPEVEQWIQEAIDLGKSDCYSIEKEDELTRWIMAKVEELREEFQFYGFESIEELNYLETEEGQKEQEEKKTEEQKVKQEELRITDGGKQGLHPNTVLKFMYRGILT |
| Length | 221 |
| Position | Head |
| Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Millerozyma.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.842 |
| Instability index | 57.54 |
| Isoelectric point | 5.28 |
| Molecular weight | 25750.60 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28680
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 94.18| 30| 34| 17| 50| 1
---------------------------------------------------------------------------
17- 48 (42.69/28.24) SQIPvDYlEEIRNRLNQVHLSLRRLADQISHN
54- 83 (51.49/21.67) SKIP.NY.SHIQNQLQVLLTQLHSISNNLDNN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.01| 23| 23| 121| 143| 2
---------------------------------------------------------------------------
121- 143 (40.23/31.41) QWIQEAIDLGKSD..CYSIEKEDEL
145- 169 (34.78/26.20) RWIMAKVEELREEfqFYGFESIEEL
---------------------------------------------------------------------------
|