Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MCDNTCFFFTIPKKRTSLNRKEGREMSETGDDLISSLYPPPPPYYKFFTEASLEKLLEWNNTNAEVATDGEKDDVKQQPNKRPPGKLKFLIPPEKPEGTHYRGFGNFWSFEDKLPSLKESGWQQLYKDDDEEITSKTKIQELHKLMHSLLLNFLELVGVVSIEPQQFHHKIEDLKLILININHILNTYRPHQSRESLIMLLKKQIENKRNEIKEIDEVSKEVKSTILSLVNIEDLTQGLTEETKQADNDENKIDTAVRKLLNEN |
Length | 264 |
Position | Middle |
Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Millerozyma. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.775 |
Instability index | 56.83 |
Isoelectric point | 5.52 |
Molecular weight | 30739.54 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28679 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 85.07| 24| 40| 25| 48| 2 --------------------------------------------------------------------------- 25- 48 (46.73/25.32) EMSETG..DDLISSLYPPPPPYYKFF 65- 90 (38.33/19.73) EVATDGekDDVKQQPNKRPPGKLKFL --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 69.40| 22| 36| 195| 216| 3 --------------------------------------------------------------------------- 195- 216 (34.15/20.06) ESLIMLLKKQIENKRNEIKEID 233- 254 (35.25/20.91) EDLTQGLTEETKQADNDENKID --------------------------------------------------------------------------- |
IDR Sequence | Start | Stop |
1) TNAEVATDGEKDDVKQQPNKRPPGKLKFLIP | 62 | 92 |
MoRF Sequence | Start | Stop |
1) KLKFLI 2) LISSLY 3) PYYKFFTE | 86 33 43 | 91 38 50 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab