<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28677
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MEESLPTRWEIELEFVQSLANIQYLNYLAQNNYLNDERFLNYLKYLEYWKNPNYAKYLVYPNCLHILTLLQSEEFRKSIINPDFMNTLMNDMVKRWQDPESGADSSPSIKAETKASSVPDLTSPAQVSSSENAVAGDPAVKN |
| Length | 142 |
| Position | Middle |
| Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Millerozyma.
|
| Aromaticity | 0.11 |
| Grand average of hydropathy | -0.540 |
| Instability index | 69.10 |
| Isoelectric point | 4.66 |
| Molecular weight | 16377.18 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28677
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.02| 15| 18| 19| 33| 1
---------------------------------------------------------------------------
19- 33 (27.47/15.61) LANIQYLNYLAQNNY
40- 54 (30.56/18.03) LNYLKYLEYWKNPNY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.56| 13| 18| 56| 73| 2
---------------------------------------------------------------------------
56- 70 (19.72/19.40) KYLVYPNCLHilTLL
77- 89 (23.84/ 8.88) KSIINPDFMN..TLM
---------------------------------------------------------------------------
|