<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28674
| Description |
Piso0_004787 protein |
| Sequence | MQSKSITLLQRIDSDIEQILQKFQDTFELATNQDKSKELLSVESLSMEANAMLIIRLCEDLLTISRHLKETWCLGSLKVDGTEEEESRKVDEIYSKFNYLTDKISQLEESNAA |
| Length | 113 |
| Position | Head |
| Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Millerozyma.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.437 |
| Instability index | 49.37 |
| Isoelectric point | 4.56 |
| Molecular weight | 13004.57 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28674
No repeats found
No repeats found
|