<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28671
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSETGDDLISSLYPPPPPYYKFFTEANLEKLLEWNSTNAEVSTDGENDDVKQQTNKRPPGKLKFLVPPEKPEGTHYRGFGNFWSFEDKLPSLKDSGWQQLYKDDDEEITSKTKIQELHKLMHSLLLNFLELVGVVSIEPQQFHYKIEDLKLILININHILNTYRPHQSRESLIMLLKKQIEKKRNEIKEIDEVSREVKSTILSLVNIENMTHGIAEETKQADNDENEIDTAVRKLLNEN |
| Length | 239 |
| Position | Middle |
| Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Millerozyma.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.750 |
| Instability index | 58.51 |
| Isoelectric point | 5.13 |
| Molecular weight | 27778.03 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28671
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.51| 18| 40| 6| 23| 1
---------------------------------------------------------------------------
6- 23 (36.11/21.05) DDLISSLYPPPPPYYKFF
48- 65 (32.40/18.27) DDVKQQTNKRPPGKLKFL
---------------------------------------------------------------------------
|