Description | Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MSETGDDLISSLYPPPPPYYKFFTEANLEKLLEWNSTNAEVSTDGENDDVKQQTNKRPPGKLKFLVPPEKPEGTHYRGFGNFWSFEDKLPSLKDSGWQQLYKDDDEEITSKTKIQELHKLMHSLLLNFLELVGVVSIEPQQFHYKIEDLKLILININHILNTYRPHQSRESLIMLLKKQIEKKRNEIKEIDEVSREVKSTILSLVNIENMTHGIAEETKQADNDENEIDTAVRKLLNEN |
Length | 239 |
Position | Middle |
Organism | Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) (Hybrid yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Millerozyma. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.750 |
Instability index | 58.51 |
Isoelectric point | 5.13 |
Molecular weight | 27778.03 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28671 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 68.51| 18| 40| 6| 23| 1 --------------------------------------------------------------------------- 6- 23 (36.11/21.05) DDLISSLYPPPPPYYKFF 48- 65 (32.40/18.27) DDVKQQTNKRPPGKLKFL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDLISSLY 2) LKFLV 3) PPYYKFFTEANLEKLLEWN | 6 62 17 | 13 66 35 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab