Description | Mediator of RNA polymerase II transcription subunit 8 |
Sequence | MSQPAALTDPLGSVPKYDFSNVPVQAFDAVRMKLAQLTHSLSKIRDDLSKADLPQWYSLQSQLTVTLTQLSSLNSTLQHFEELLDSTVPYPLPHFPTTAHEGLLTTLMRKKQIPEVEAWIKDAIDHSGIDINNENQEDLEKFIQKDKAITNWALDFINHEHSNYSFQGLYTAEDLSNGAGDSKIPLYRSTTFKTKNVSPFSIDSVLKYIYQGSTNESSSVSE |
Length | 222 |
Position | Head |
Organism | Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.448 |
Instability index | 35.25 |
Isoelectric point | 5.10 |
Molecular weight | 24940.56 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | protein-macromolecule adaptor activity GO:0030674 IEA:EnsemblFungi RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IEA:EnsemblFungi TBP-class protein binding GO:0017025 IEA:EnsemblFungi transcription corepressor activity GO:0003714 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP28661 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) IDSVLKYIYQGS 2) SKIPLYR | 202 182 | 213 188 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab