<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28654
| Description |
Uncharacterized protein |
| Sequence | MTDRLTQLQQCLDQIMEQFGSAINYVDRNHDFEPHNELEDKHTDPQATIATQEDFDRNIDELTTDMILKTRQIIKLIDSLPGVDVSAEEQLHRIDALQKKLVSVEEAKIEAIKRKDTLMKNVEELIGELAKGIANSRRLNDAQS |
| Length | 144 |
| Position | Middle |
| Organism | Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.652 |
| Instability index | 45.19 |
| Isoelectric point | 4.75 |
| Molecular weight | 16498.38 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28654
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.25| 14| 15| 75| 89| 1
---------------------------------------------------------------------------
75- 89 (19.53/14.28) KlIDSLPGVDVSAEE
93- 106 (22.73/12.26) R.IDALQKKLVSVEE
---------------------------------------------------------------------------
|