| Description | Uncharacterized protein |
| Sequence | MKQTAVIFIEKATPSTITQFHDVLSTHVISVQEKWSFELKTFRSSVKNIPSDDTRVMYSLTLTHRDNQTVTIKKHSAIVTGHHVTEQLTSNGCSTGFPESFDNIITSKLSNIWTQRQSIKGDFGSSYKTSDLVVRAANVFSSSGFKGLLLELEGDESSEMDFDTKVETIQSLLDEISSREFKLSKDRMKDTEPNFLCDLAYQYVKVLD |
| Length | 208 |
| Position | Head |
| Organism | Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.370 |
| Instability index | 33.86 |
| Isoelectric point | 5.70 |
| Molecular weight | 23491.15 |
| Publications |
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP28652 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DFDTKVETIQSLLDEISSREFKL 2) VKVLD | 161 204 | 183 208 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab