Description | Uncharacterized protein |
Sequence | MKQTAVIFIEKATPSTITQFHDVLSTHVISVQEKWSFELKTFRSSVKNIPSDDTRVMYSLTLTHRDNQTVTIKKHSAIVTGHHVTEQLTSNGCSTGFPESFDNIITSKLSNIWTQRQSIKGDFGSSYKTSDLVVRAANVFSSSGFKGLLLELEGDESSEMDFDTKVETIQSLLDEISSREFKLSKDRMKDTEPNFLCDLAYQYVKVLD |
Length | 208 |
Position | Head |
Organism | Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.370 |
Instability index | 33.86 |
Isoelectric point | 5.70 |
Molecular weight | 23491.15 |
Publications |
Annotated function |
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP28652 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) DFDTKVETIQSLLDEISSREFKL 2) VKVLD | 161 204 | 183 208 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab