<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28652
| Description |
Uncharacterized protein |
| Sequence | MKQTAVIFIEKATPSTITQFHDVLSTHVISVQEKWSFELKTFRSSVKNIPSDDTRVMYSLTLTHRDNQTVTIKKHSAIVTGHHVTEQLTSNGCSTGFPESFDNIITSKLSNIWTQRQSIKGDFGSSYKTSDLVVRAANVFSSSGFKGLLLELEGDESSEMDFDTKVETIQSLLDEISSREFKLSKDRMKDTEPNFLCDLAYQYVKVLD |
| Length | 208 |
| Position | Head |
| Organism | Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.370 |
| Instability index | 33.86 |
| Isoelectric point | 5.70 |
| Molecular weight | 23491.15 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi
TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi
negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28652
No repeats found
No repeats found
|