Description | Mediator of RNA polymerase II transcription subunit 4 |
Sequence | MNSSSSLHLSQQDSNNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAKNQQSTQYSETGAHEEADGSIDLDLDLFNPDEF |
Length | 274 |
Position | Middle |
Organism | Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Eremothecium. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.774 |
Instability index | 51.40 |
Isoelectric point | 4.51 |
Molecular weight | 31113.30 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141 |
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi |
Binary Interactions |
Repeats | >MDP28651 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 159.63| 48| 219| 4| 51| 2 --------------------------------------------------------------------------- 4- 51 (82.37/46.23) SSSLHLSQQDSNNDELNHV.....QQVTLYKDLCQFEEDLQKLVVSVDKFSPD 220- 272 (77.26/42.98) SSDTPSSKPDSKSESFEFTgkaknQQSTQYSETGAHEEADGSIDLDLDLFNPD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FEFTGKAKN 2) QSTQYSETGAHEEADGSIDLDLDLFNPDEF | 235 245 | 243 274 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab