<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28651
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MNSSSSLHLSQQDSNNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQEPPQKGQSQEEDEVTPTHSSDTPSSKPDSKSESFEFTGKAKNQQSTQYSETGAHEEADGSIDLDLDLFNPDEF |
| Length | 274 |
| Position | Middle |
| Organism | Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) (Yeast) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Eremothecium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.774 |
| Instability index | 51.40 |
| Isoelectric point | 4.51 |
| Molecular weight | 31113.30 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
transcription by RNA polymerase II GO:0006366 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28651
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 159.63| 48| 219| 4| 51| 2
---------------------------------------------------------------------------
4- 51 (82.37/46.23) SSSLHLSQQDSNNDELNHV.....QQVTLYKDLCQFEEDLQKLVVSVDKFSPD
220- 272 (77.26/42.98) SSDTPSSKPDSKSESFEFTgkaknQQSTQYSETGAHEEADGSIDLDLDLFNPD
---------------------------------------------------------------------------
|