<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28641
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MEAPPVTMMPVTGGTINMMEYLLQGSVLDHSLESLIHRLRGLCDNMEPETFLDHEMVFLLKGQQASPFVLRARRSMDRAGAPWHLRYLGQPEMGDKNRHALVRNCVDIATSENLTDFLMEMGFRMDHEFVAKGHLFRKGIMKIMVYKIFRILVPGNTDSTEALSLSYLVELSVVAPAGQDVVSDDMKNFAEQLKPLVHLEKIDPKRLM |
| Length | 208 |
| Position | Head |
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.107 |
| Instability index | 38.06 |
| Isoelectric point | 6.06 |
| Molecular weight | 23630.39 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28641
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.50| 20| 70| 42| 63| 1
---------------------------------------------------------------------------
42- 63 (33.96/23.70) LCDNMEPETF.LDHEmvFLLKGQ
114- 134 (34.54/18.19) LTDFLMEMGFrMDHE..FVAKGH
---------------------------------------------------------------------------
|