| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSYDDTIPAYYYYVDPENYYQPQVPNPLNDLISQYDLDDISQQVARTNTDGSKAVKLRKSYKNQIAELSGKFSNIPTRENGKGGEIAQVLFQNNPDMMANVTTTQDMTEEEYRTAMANRDMALFGKNNMDWDMASTVLSQFDRSFPSEFQNVQGFNIDDLAFDLDGTGRSNSKKRKVNISSGSSMTTPNGNDIEDIKRRRLD |
| Length | 202 |
| Position | Head |
| Organism | Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) (Yeast) (Fabospora phaffii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Tetrapisispora. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.878 |
| Instability index | 49.92 |
| Isoelectric point | 4.66 |
| Molecular weight | 22953.02 |
| Publications | PubMed=22123960 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi transcription open complex formation at RNA polymerase II promoter GO:0001113 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats | >MDP28631 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) DIKRRRL 2) YDDTIPAYYYYVDPENYY | 195 3 | 201 20 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab