| Description | Mediator of RNA polymerase II transcription subunit 20 |
| Sequence | MTRTAVIFNEKATPDALVEFKDALSNTLTSILEPWSLEFKTFRKTTKNERSSNSSNIMYSVSFAHHDKGTVLIHDKYAIITTNNSNDIPKDLILNTCSTGTTEPIDNLLALRLSNIWSQRQGIRGDAGETLQTTNLIVRVVNLFSSTGFKGLLIELNSLDDDVSEEEFKISVDHVQTVLKDINCKDFKLSTDRLNFNENNGNRKLNILSDLAYQYIQVLEY |
| Length | 221 |
| Position | Head |
| Organism | Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) (Yeast) (Fabospora phaffii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetaceae> Tetrapisispora. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.334 |
| Instability index | 22.24 |
| Isoelectric point | 5.26 |
| Molecular weight | 24984.82 |
| Publications | PubMed=22123960 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | protein domain specific binding GO:0019904 IEA:EnsemblFungi TFIID-class transcription factor complex binding GO:0001094 IEA:EnsemblFungi transcription coactivator activity GO:0003713 IEA:EnsemblFungi |
| GO - Biological Process | negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to chemical stimulus GO:0010689 IEA:EnsemblFungi negative regulation of ribosomal protein gene transcription from RNA polymerase II promoter in response to nutrient levels GO:0010691 IEA:EnsemblFungi positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi |
| Binary Interactions |
| Repeats |
>MDP28619
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.01| 15| 17| 162| 176| 2
---------------------------------------------------------------------------
162- 176 (25.28/16.94) DVSEEEFKISVDHVQ
181- 195 (26.73/18.26) DINCKDFKLSTDRLN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.61| 16| 24| 109| 125| 3
---------------------------------------------------------------------------
109- 125 (24.45/20.85) LALRLSNIWSQrQGIRG
136- 151 (27.16/17.75) LIVRVVNLFSS.TGFKG
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LEPWSLEFKT 2) YIQVLEY | 32 215 | 41 221 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab