<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28618
Description |
Uncharacterized protein |
Sequence | MSASYWTSTQRFQWQHTKESLDKERQKLWILEYQLFPQGLNIVIDPKPNNLNLDSATKNPGNNVSLSGNMNVPVTKNIPISHRDLHYDKDFNLRIYCYFLIMKLGRRLNIRQCALATAQIYLSRFLIKVSIREINLYLLVTTCVYLACKVEECPQYIRTLVSEARSLWPEFIPPDPTKITEFEFYLIEELESYLIVHHSYTSMEQIINILNDKKYNLVISSEDIQNCWSLINDSYISDVHLLYPPHVIAMACLFITICIRGKVSKSSLNGTQSSTNSLKINNDNYNNSLNIDRRSHSIFNRFMAESHVDLDEVMDTIQELITLYDHWDKYHESWIKFLLHTLYLRPNRVNQPHASITPDNL |
Length | 361 |
Position | Kinase |
Organism | Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) (Yeast) (Fabospora phaffii) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Tetrapisispora.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.271 |
Instability index | 44.83 |
Isoelectric point | 6.50 |
Molecular weight | 42316.98 |
Publications | PubMed=22123960
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP28618
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.80| 19| 101| 126| 167| 1
---------------------------------------------------------------------------
128- 146 (31.50/64.26) KVSIREINLYLLVTTCVYL
176- 194 (32.30/ 6.68) PTKITEFEFYLIEELESYL
---------------------------------------------------------------------------
|