<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28603

Description Uncharacterized protein
SequenceMSADYWNSSQRNQWQLTRYSLLEARRKIIYLERKMIQNGLIKDTPHINYDYNMRIYLHNLVLKLGRRMNVRQVAIATAEVYCTRFLTRASLKEINVYLLVTTCLYVACKIEECPQHIRLIVSEARNLWPEYIPQDVTKLAEFEFYLIEEMDSYLLLHHPYKSLLQLKHYFEQKYDVYGFKLSDEEMQNCWSLINDSYITDLHLLLPPHIIAVAAIYITIVLKKNLSQLKNKEENGVSNNSIANNVDSNNPQSSYTQNTAGASVKSGSTVSDNKELNIDDLINLSKPNSQEEDASKAKSNEVSPSKNNSTQVSNPQHHQGDANQQQSSTKTTHTTAQDLVNFDLDILDDDTIRINKFMNFVEHSHINLDEVVEAVQDMINVYVLWNRYNEQSVRKALQVMLWKR
Length403
PositionKinase
OrganismCandida parapsilosis (strain CDC 317 / ATCC MYA-4646) (Yeast) (Monilia parapsilosis)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
Aromaticity0.09
Grand average of hydropathy-0.491
Instability index49.47
Isoelectric point6.13
Molecular weight46816.43
Publications
PubMed=19465905
PubMed=22192698

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:EnsemblFungi

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding	GO:0000979	IEA:EnsemblFungi

GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by galactose	GO:0000411	IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle	GO:0010673	IEA:EnsemblFungi









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28603
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.99|      15|      16|     238|     252|       1
---------------------------------------------------------------------------
  238-  252 (25.54/16.86)	NNSIANNVDSNNPQS
  256-  270 (23.45/14.95)	QNTAGASVKSGSTVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.85|      12|      18|     374|     386|       2
---------------------------------------------------------------------------
  374-  386 (18.15/14.29)	VQDMINVyVLWNR
  392-  403 (21.70/11.56)	VRKALQV.MLWKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.39|      25|      67|      16|      46|       4
---------------------------------------------------------------------------
   16-   46 (34.73/51.76)	LTRYSLLEARrkiIYLerkMIQNGL.....IKDTPH
   86-  115 (38.66/33.59)	LTRASLKEIN...VYL...LVTTCLyvackIEECPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.71|      15|      23|     139|     153|       7
---------------------------------------------------------------------------
  139-  153 (25.97/18.47)	LAEFEFYLIEEMDSY
  163-  177 (26.74/19.22)	LLQLKHYFEQKYDVY
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28603 with CycC domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KEENGVSNNSIANNVDSNNPQSSYTQNTAGASVKSGSTV
2) LNIDDLINLSKPNSQEEDASKAKSNEVSPSKNNSTQVSNPQHHQGDANQQQSSTKTTHTT
231
275
269
334










Molecular Recognition Features






MoRF SequenceStartStop




NANANA