<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28603
| Description |
Uncharacterized protein |
| Sequence | MSADYWNSSQRNQWQLTRYSLLEARRKIIYLERKMIQNGLIKDTPHINYDYNMRIYLHNLVLKLGRRMNVRQVAIATAEVYCTRFLTRASLKEINVYLLVTTCLYVACKIEECPQHIRLIVSEARNLWPEYIPQDVTKLAEFEFYLIEEMDSYLLLHHPYKSLLQLKHYFEQKYDVYGFKLSDEEMQNCWSLINDSYITDLHLLLPPHIIAVAAIYITIVLKKNLSQLKNKEENGVSNNSIANNVDSNNPQSSYTQNTAGASVKSGSTVSDNKELNIDDLINLSKPNSQEEDASKAKSNEVSPSKNNSTQVSNPQHHQGDANQQQSSTKTTHTTAQDLVNFDLDILDDDTIRINKFMNFVEHSHINLDEVVEAVQDMINVYVLWNRYNEQSVRKALQVMLWKR |
| Length | 403 |
| Position | Kinase |
| Organism | Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) (Yeast) (Monilia parapsilosis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.491 |
| Instability index | 49.47 |
| Isoelectric point | 6.13 |
| Molecular weight | 46816.43 |
| Publications | PubMed=19465905
PubMed=22192698
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP28603
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.99| 15| 16| 238| 252| 1
---------------------------------------------------------------------------
238- 252 (25.54/16.86) NNSIANNVDSNNPQS
256- 270 (23.45/14.95) QNTAGASVKSGSTVS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.85| 12| 18| 374| 386| 2
---------------------------------------------------------------------------
374- 386 (18.15/14.29) VQDMINVyVLWNR
392- 403 (21.70/11.56) VRKALQV.MLWKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.39| 25| 67| 16| 46| 4
---------------------------------------------------------------------------
16- 46 (34.73/51.76) LTRYSLLEARrkiIYLerkMIQNGL.....IKDTPH
86- 115 (38.66/33.59) LTRASLKEIN...VYL...LVTTCLyvackIEECPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.71| 15| 23| 139| 153| 7
---------------------------------------------------------------------------
139- 153 (25.97/18.47) LAEFEFYLIEEMDSY
163- 177 (26.74/19.22) LLQLKHYFEQKYDVY
---------------------------------------------------------------------------
|