| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MPTEEKPDNYIQKRLDALSDIDFKIVSLLENFSSFFETYSNKDKDQFINGSKQIFDTLGKVAIDLRKEVKHMDDNIGVYDKNKDGIMILPINVDQKNGELGKLKLNSELKELSELLNDGNKERPVSVEQVVGADRGNTEEAEEEVPNANKDTMIEDGIEDTSQDVSMAD |
| Length | 169 |
| Position | Head |
| Organism | Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) (Yeast) (Monilia parapsilosis) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Debaryomycetaceae> Candida/Lodderomyces clade> Candida. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.763 |
| Instability index | 36.68 |
| Isoelectric point | 4.41 |
| Molecular weight | 19058.95 |
| Publications | PubMed=19465905 PubMed=22192698 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats | >MDP28599 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) EEEVPN 2) IMILPI 3) MIEDGIEDT 4) NYIQKRLD 5) SELKELSEL | 142 86 153 9 107 | 147 91 161 16 115 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab