<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28590
Description |
Uncharacterized protein |
Sequence | MFGDHVVGVPIDNPSTVILWEVMFRLVNGLQLTPKTSINNRVPPPTTYNLGRREYKEKQWRNLEDQNLGESISLHCSPVSMYDYEAIGTNEVELRLIENTEETQRKSGHLTEIKAIASVRHSHILHSIK |
Length | 129 |
Position | Tail |
Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.493 |
Instability index | 52.73 |
Isoelectric point | 6.29 |
Molecular weight | 14778.60 |
Publications | PubMed=22089132
PubMed=24767513
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28590
No repeats found
|