<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28590
| Description |
Uncharacterized protein |
| Sequence | MFGDHVVGVPIDNPSTVILWEVMFRLVNGLQLTPKTSINNRVPPPTTYNLGRREYKEKQWRNLEDQNLGESISLHCSPVSMYDYEAIGTNEVELRLIENTEETQRKSGHLTEIKAIASVRHSHILHSIK |
| Length | 129 |
| Position | Tail |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.493 |
| Instability index | 52.73 |
| Isoelectric point | 6.29 |
| Molecular weight | 14778.60 |
| Publications | PubMed=22089132
PubMed=24767513
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28590
No repeats found
|