<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28581

Description Mediator of RNA polymerase II transcription subunit 12
SequenceMIPHSSAGVQPWGRSLRALNNGSGRVDASQALVQSDPQLEKLSMSMPQPLPRQPAVIDLTANTSDSQDREPPAKRLKLEAPPGSCPPEGSPAPGSGEARSTPGTASSKPNPLAWRGRPVWSFQALISETTGAVETKEDDTNSQGKTPASPPPLPLIPWKPAPQEASGSNSAKPADVASAKEVQTTPYRIVVPPVAPKLKGERVADFSPWTGNHPEDTLNDHTAKQGHYDRTQVSQNESNTARPSLYAQLKHRSGLQMLSSVFAAALEKRQSHSTIATPSSFKPPPRVTLTDNKREAWLRDLANPSVPLRRLSRTIPHGIRGKVLLDQCLGKGIPVPRAIWLARCVGANEIRAFKRKGTSGTLALGLETKWVRDWTSTVQQFLESVIGTCGSSDWKIKMTYAVSLTSRLFFERLLDHDQYLSWFLVSLEAAPLNTVPVWLLMLGIYWNNIMRYRKRGRRLAEVLLEKLRLIKQPGQPTALEPLVDRLSRCIRRLVLEHTSSVILPASWDQYKDLIASCLNLKELPDKTTLQNLAERNVRVQLPTNRQGTSQQLPQQHVIHLFDSIRSAHDVLSTSSACLNAVEDKATLVAKLLEWAATPFRHGSRRVYTSVRLLRKWKMSGMDVESYILAFLADTQITSRVNMDNVYHIIAELVRSQTFSVGRYLQWLMAKGVANDPLPDQTKAISDDVRLLIQLPLARLPEYVRNLRNTLLSRAGITASHEESIVETVKASIAQRLPKIFGPQASDAMLTDQPLSSLTWAVKSEIGLWIRRGVSGHCRDPVRYADFTPWKYAQALTAARKYAHIPMLADSGVSALTPVEFYNIRDVLESFGDISMLADVLKQATNCDDNIVLASVADTINYHFDSLSVIGAATDLFKGLIESYARLKRLGAPGLDLIFSLIELGLRMPSEFNTVALLRQDLSRIENKSALAAPSPLSDNLSMAFNDADSSFQEKLDQILFSGGGMDESTMDSIFNSLTGALANENGHVKLSANDICRYLAYLRSFHPKRFDARLVRWVCGVLKSPSRFAMVRVLPPLIGVGCVTIHAFVMLVKKLLQSERIASVVPKVTDLQLDLLELLVPQEPSGSRYTDMVTYRYYLAQQEFIDKHPEECLNIIRAAVPLISTRQTENAGEANAADLTKCAMILLQTLLTQKPERMVQCCTQKLVGQDPASTMILQKALDALLGFNPQDPQAMSEAERVIGMNNDFSLPICQLKLQLLFNAEAGNGVDNGIVDVMFKAAMADARSKRSHWYGLVSLMNQDAVRQIRERAEKGFFSVPILEEPIGDPTVADKSNSIETARLYLAIIEKLAYSIPETGVPSVAPMLVEKMELLLQKFITMQPNPSTPAESCQIAQARSNFERSLAFWFSALLRLVVIHRSAFNTAALTPKPIGLQEQARMLVSIFCITLARLPDRVIRLYPSANYFPHPVQSESYRPCPGILLQTHALDVAAALIDTFPDEARQQCARFLKEKCPPFLQFQNDSRFLYLLGPVMDAPTLNSSQPASLPSPAAGGSTPTPTGNLAGGPPNSQSLSSASGLPAGLSEGVNCIASHLRLQYRGRVLGAYPVRPWELLEDAAPIVGMNDTAVSLKYFDARRVRA
Length1600
PositionKinase
OrganismAspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.07
Grand average of hydropathy-0.169
Instability index48.47
Isoelectric point8.97
Molecular weight176559.93
Publications
PubMed=22045919

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28581
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.28|      23|      27|     786|     809|       1
---------------------------------------------------------------------------
  786-  808 (42.63/24.59)	FTPWKYAQALTAARKYAHIPMLA
  815-  837 (38.65/21.94)	LTPVEFYNIRDVLESFGDISMLA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     152.96|      43|     453|     894|     936|       2
---------------------------------------------------------------------------
  254-  284 (33.90/17.38)	...........GLQMLSSVFAAALeKRQSHSTIATPSSFKPP...
  894-  936 (73.53/46.97)	LDLIFS.LIELGLRMPSEFNTVAL.LRQDLSRIENKSALAAPSPL
 1364- 1392 (45.52/26.05)	LAFWFSaLLRLVVIHRSAFNTAAL................TPKPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     446.38|     140|     317|     297|     439|       3
---------------------------------------------------------------------------
  297-  439 (237.40/203.63)	W.LRDLANPSVPLRRLSRTiphGIRGKVLLDQCL........GKGIPVPRAI.WLARCVGANEIRAFKRKGTSGTLALGLETKWVR..DWTSTVQQFLESVIGTCGSSDWKIKMTYAVSLTSRL..FFERLLDHDQYLSWFLVSLEAAPLNTVPVWL
  616-  769 (208.99/169.03)	WkMSGMDVESYILAFLADT...QITSRVNMDNVYhiiaelvrSQTFSVGRYLqWLMAKGVANDPLPDQTKAISDDVRLLIQLPLARlpEYVRNLRNTLLSRAGITASHEESIVETVKASIAQRLpkIFGPQASDAMLTDQPLSSLTWAVKSEIGLWI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.41|      10|     894|     517|     526|       5
---------------------------------------------------------------------------
  517-  526 (19.14/11.43)	CLNLKELPDK
 1406- 1415 (19.27/11.57)	CITLARLPDR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     126.09|      33|      34|     128|     160|       6
---------------------------------------------------------------------------
   93-  116 (32.14/12.67)	..PGSGEARsTPGTASS................KPN......PL.AWRG
  128-  160 (60.96/30.89)	ETTGAVETK.EDDTNSQGKTPASP.........PPL......PLIPWKP
  164-  209 (32.99/13.20)	EASGSNSAK.PADVASAKEVQTTPyrivvppvaPKLkgervaDFSPW..
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     110.86|      34|     376|    1172|    1206|       7
---------------------------------------------------------------------------
 1144- 1160 (20.54/ 8.49)	............MIL...LQTLL...TQKPERMVQ
 1163- 1197 (53.89/40.51)	TQKLVGQDPASTMILQKaLDALLGFNPQDPQAMSE
 1198- 1224 (36.44/21.46)	AERVIGMNNDFSLPICQ.LKLQLLFNAE.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.34|      20|    1033|      36|      59|      10
---------------------------------------------------------------------------
   36-   55 (37.46/20.47)	DPQLEKLSMSMPQ...PLPRQPA
   70-   92 (31.88/ 9.38)	EPPAKRLKLEAPPgscPPEGSPA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28581 with Med12 domain of Kingdom Fungi
Unable to open file!