<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28572

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMTSSEQWGTFLQQCLLHRIDAAEFKNLTRLLMQRYPIGEAQLLDVLLETRLATGIKWDPLPPLYIDCLCKMGLVRTSTMLNSLLKHSSIHDKLPSAGGSEATAAAAAAVQGKQKRKCYTLMTDIRVVQDAMLSVSTGTASKTFAEALSIFASIVDWIQAVVAWHNSHLDTSHQTGGLMSSPDAVSLFESLGILLAALSGTAKGLEVLSADSHEALKIKLGQALSAYLPLCVEVSLPLRNRLDSLQKEFNLFGEPSSKALDVSMMENVNVNALQFEDSVMDGPVINSRAGLYVYINAMLVGRPLVDDSMLLNFLSNRYGGHYQVLIEELITASFDVLSNANYRNESSRTMFLFRSFLVNKLPTFIAAMLAASIVSLPLPMELCISHALSRLDPNTFPSFSQMFAMQSNTVLSDVRQEFLFACASHKLIPESSIERLLGENPMQTLPVGGPYNKDELVSQINANPERAEQLINEIESMEGNAGAIVGAITDVMHHLCNQKETMTLKNICNSLSRRPQALDVILLFRSLKQVLQPLCALLDAWHWDEDQGESQPVYDEFGSILLLVLTFKFRYDLRPQDMGIGGSNSFVLRLLENGFCSQKLDDLSEKQNKNLGSWINALFMAEGISEETMSACSPQEFYMLVTTLFNQSLSACEAGKLDFDTLKGGFEYLLEPFLLPSLILALNWLGNHIWESESDPSIPLKALHSLISPSSISGEAKEIHRTVLNITARSLEEQLKSIRARQPDDTIKPILEALEPHLSFQRSGSTRRSELESWTAHTPGGLLASIRSTFQSLILWSTSPDMSMAPQSYTHRQFIAGIHIQGSMRVLCALIDELKLQATTSPTNTTGSSDLALDIAATMICAPLADSFAVDQNTYSPHHHIDPTNTTKEIPPRNPILTPRGALYQLHDSVPKICEKDPLRAEIIVRLWRRVNAALTPPSQLDMNNIIQNMQLGVGVGGPGQMDLDTSGAGGHEEESTINQMLDNAVAAGMDGGGGAGGMGGMGSGGLDTSIDDVLNAADMAVGNPEFLDLDMEGLF
Length1035
PositionTail
OrganismAspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
Aromaticity0.06
Grand average of hydropathy-0.021
Instability index47.15
Isoelectric point5.01
Molecular weight113220.26
Publications
PubMed=22045919

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28572
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     170.41|      54|     510|     413|     482|       1
---------------------------------------------------------------------------
  413-  466 (93.78/61.49)	VRQEFLFACASHKLIPESSIERLLGENPMQTLPVGGPYNKDELVSQI.NANPERA
  487-  519 (44.49/48.07)	ITDVMHHLCNQKETMTLKNICNSLSRRP.QALDV.....................
  892-  920 (32.13/12.90)	.........................RNPILT.PRGALYQLHDSVPKIcEKDPLRA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     300.36|      78|     160|      15|      95|       4
---------------------------------------------------------------------------
   15-   92 (130.62/80.48)	LLHRIDAAE.FKNLTRLLMQRYPIGEAQLLDVL.LETRLATGIKWDPLPPLYIDC.LCKMGLVRTSTMLNSLLKHSSIHDK
  177-  253 (104.64/62.16)	LMSSPDAVSlFESLGILLAA..LSGTAKGLEVLsADSHEALKIKLGQALSAYLP..LCVEVSLPLRNRLDSLQKEFNLFGE
  257-  313 (65.10/40.85)	...........KALDVSMMENVNVNALQFEDSV.MDGPV...INSRAGLYVYINAmLVGRPLVDDSMLLNFL.........
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      93.39|      26|      32|     954|     984|       5
---------------------------------------------------------------------------
  937-  957 (25.60/10.27)	PSQLDM..............NNIIQNM.....qlgvGVGG
  958-  997 (32.63/27.56)	PGQMDLdtsGAGGHeeESTINQMLDNAvaagmdgggGAGG
  998- 1023 (35.16/16.65)	MGGM.....GSGGL..DTSIDDVLNAA.......dmAVGN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.42|      23|      32|     817|     841|       6
---------------------------------------------------------------------------
  817-  841 (36.70/32.64)	IHIQGSMrvLCA.LIDELKL.QATTSP
  852-  876 (32.73/21.65)	LDIAATM..ICApLADSFAVdQNTYSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.92|      17|      34|     733|     749|       7
---------------------------------------------------------------------------
  733-  749 (29.10/16.58)	QLKSIRARQPDDTIKPI
  769-  785 (29.81/17.15)	ELESWTAHTPGGLLASI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.92|      22|     141|     530|     551|      10
---------------------------------------------------------------------------
  530-  551 (44.66/22.38)	LQP..LCALLDAWHWDED...QGESQP
  669-  695 (30.26/13.16)	LEPflLPSLILALNWLGNhiwESESDP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28572 with Med5 domain of Kingdom Fungi
Unable to open file!