<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28571
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MADILTQLQTCLDQLATQFYATLCYLTTYHDNIPATPPPTTTTPSAAPLLAKIPKNASTPPVPASAPQAAQSQSQASPPPPDSTNPPGQGPNADNQQQQNADGTAEGLPAPDSPATFAARQRELARDLVIKEQQIEYLIT |
Length | 140 |
Position | Middle |
Organism | Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.529 |
Instability index | 71.84 |
Isoelectric point | 4.35 |
Molecular weight | 14774.23 |
Publications | PubMed=22045919
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28571
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.74| 18| 21| 56| 75| 1
---------------------------------------------------------------------------
58- 75 (31.82/13.63) STPP.....VPASAPQAAQSQSQ
77- 99 (28.92/ 6.65) SPPPpdstnPPGQGPNADNQQQQ
---------------------------------------------------------------------------
|