<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28570
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MSDRASSASFRVGPPSPSSPAAGALKQNQLPAPLSDRIPQTPTSPPLMSVSAQNYATNFVSSQASPNQATSQSATLSSPPSSAPMSTQASQQPTVGTANSFPTPASSVSGHFPGATSFDDSEHTDKSMGSAAPDTGAQAANMNAAAIQQAEHRRTDHDRHTEGINMEVGVRDFAANNGGDAMDIDSEAPASSSRSEPSLESLQKNFSSAFHVCKSSHIATGPDPSLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKTEPGAPGSLRHMTMWPEEEWQNQKVFGKEIKVADMDSALHNLQMRAMKMEPGTVPNNEYWEDVLGHEKPSKHAGGDASKKGVAPPPNGVRISQPNGTPAPVSDQERARPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGMGKKKRKKVGRSDGEMAF |
| Length | 438 |
| Position | Head |
| Organism | Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.793 |
| Instability index | 53.55 |
| Isoelectric point | 6.47 |
| Molecular weight | 46474.70 |
| Publications | PubMed=22045919
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28570
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.55| 11| 28| 115| 125| 1
---------------------------------------------------------------------------
115- 125 (20.24/13.75) ATSFDDSEH..TD
144- 156 (14.31/ 7.76) AAAIQQAEHrrTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 138.45| 24| 24| 14| 37| 2
---------------------------------------------------------------------------
14- 37 (41.67/17.54) PPSPSSPAAGALK.Q.NQLPAPLSDR
39- 63 (35.20/13.74) PQTPTSPPLMSVSaQ.NYATNFVSSQ
65- 86 (27.76/ 9.37) SPNQATSQSATLS.S.PPSSAPMS..
360- 380 (33.83/12.94) PP....PNGVRIS.QpNGTPAPVSDQ
---------------------------------------------------------------------------
|