Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSDRASSASFRVGPPSPSSPAAGALKQNQLPAPLSDRIPQTPTSPPLMSVSAQNYATNFVSSQASPNQATSQSATLSSPPSSAPMSTQASQQPTVGTANSFPTPASSVSGHFPGATSFDDSEHTDKSMGSAAPDTGAQAANMNAAAIQQAEHRRTDHDRHTEGINMEVGVRDFAANNGGDAMDIDSEAPASSSRSEPSLESLQKNFSSAFHVCKSSHIATGPDPSLDLISLYGLGPVAKSVARMDPVTGEKINRLRKSYEGKLKGLGLAGRNKPVKTEPGAPGSLRHMTMWPEEEWQNQKVFGKEIKVADMDSALHNLQMRAMKMEPGTVPNNEYWEDVLGHEKPSKHAGGDASKKGVAPPPNGVRISQPNGTPAPVSDQERARPSRGRKRHYDDNSFVGYGEGYADDDDDGAFYSNSEGMGKKKRKKVGRSDGEMAF |
Length | 438 |
Position | Head |
Organism | Aspergillus kawachii (strain NBRC 4308) (White koji mold) (Aspergillus awamori var. kawachi) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Aspergillus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.793 |
Instability index | 53.55 |
Isoelectric point | 6.47 |
Molecular weight | 46474.70 |
Publications | PubMed=22045919 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669 ECO:0000256 RuleBase:RU366036 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28570 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 34.55| 11| 28| 115| 125| 1 --------------------------------------------------------------------------- 115- 125 (20.24/13.75) ATSFDDSEH..TD 144- 156 (14.31/ 7.76) AAAIQQAEHrrTD --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 138.45| 24| 24| 14| 37| 2 --------------------------------------------------------------------------- 14- 37 (41.67/17.54) PPSPSSPAAGALK.Q.NQLPAPLSDR 39- 63 (35.20/13.74) PQTPTSPPLMSVSaQ.NYATNFVSSQ 65- 86 (27.76/ 9.37) SPNQATSQSATLS.S.PPSSAPMS.. 360- 380 (33.83/12.94) PP....PNGVRIS.QpNGTPAPVSDQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DDGAFYSNSEGMGKKKRKKVGRSDGEMAF 2) HYDDNSFVGYGEGYADD | 410 392 | 438 408 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab