<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28565

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQDLTRMIHILDTEHPWDLHSIPSDHREAITCLEWDQSGSRLLSADADGQIKCWSMADHLANSWESSVGSLVEGDPIVALSWLHNGVKLALHVEKSGASSFGEKFSRVKFSPSLTLFGGKPMEGWIAVTVSGLVTVSLLKPSGQVLTSTESLCRLRGRVALADIAFTGGGNIVVATADGSSASPVQFYKVCVSVVSEKCRIDTEILPSLFMRCTTDLNRKDKFPAITHLKFLARDMSEQVLLCASSQTSSIVECWSLRKEGLPVNNIFQQISPVVGDKQPTILKWRILSATNDLDRVSAVALPKLPISLTNTDLKVASDTQFYPGLGLALAFHDGSVHIVHRLSLQTMAVFYSSATPRPVDEPAIKRPRTAGPAVHFKAMQLSWTSLALVGIDNQGKVSCLCVHVAGGAPWQVGAALQQAGAPCTWSCVAGPLWAQDRTALLPTGALAGASATALWGDPASCPQVLSTRILAMKASLCKLSPCTVTRVCDYHTKLFLIAISSTLKSLLRPHFLNTPDKSPGDRLTEICAKITDVDIDKVMINLKTEEFVLDMNTLQALQQLLQWVXXXXXXXXXXXXXQGSLLRPGHSFLRDGTSLGMLRELMVVIRIWGLLKPSCLPVYTATSDTQDSMSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPASDGLVSRLQPKQPLRLQFGRAPTLPGSAATLQLDGLARAPGQPKIDHLRRLHLGACPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLAVEGHGPEACVTSRAAGEAPAFVQLGPWPTHRPPGTPRSLDHPHPEDRL
Length875
PositionTail
OrganismMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca.
Aromaticity0.06
Grand average of hydropathy0.009
Instability index48.33
Isoelectric point7.83
Molecular weight93915.69
Publications
PubMed=22002653

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
catalytic activity	GO:0003824	IEA:InterPro

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28565
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.04|      13|     296|     564|     578|       1
---------------------------------------------------------------------------
  564-  578 (22.71/18.47)	PHFLNTPDksPGDRL
  863-  875 (27.33/15.59)	PRSLDHPH..PEDRL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.64|      16|      21|     459|     476|       2
---------------------------------------------------------------------------
  459-  476 (26.87/20.47)	VAGgaP.W.QVGAALQQAGA
  483-  500 (23.76/11.31)	VAG..PlWaQDRTALLPTGA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     322.40|     104|     200|       1|     136|       3
---------------------------------------------------------------------------
   22-  136 (177.25/152.68)	EKWSKSTHCPSVPLACAWSCRNLIAFTMD.......LRSDDQDLTrmihilDTEHPWDLHsipSDHREAITCLEW...DQSGSRLL..SADADGQIKCWSM.ADHL.ANSWESSVGSLVeGD..PIVaLSW
  157-  233 (93.72/41.62)	EKFSRVKFSPSLTLFGGKPMEGWIAVTVSglvtvslLKPSGQVLT......STESLCRLR...G..RVALADIAF....TGGGNIV..VATADG.....................................
  275-  339 (51.43/16.63)	................................................................DKFPAITHLKFlarDMSEQVLLcaSSQTSSIVECWSLrKEGLpVNNIFQQISPVV.GDkqPTI.LKW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     102.00|      22|      32|     741|     762|       4
---------------------------------------------------------------------------
  719-  739 (29.03/12.07)	.PS.QLL.IPSLDWLPASDGLVSR
  741-  762 (39.65/18.91)	QPK.QPL.RLQFGRAPTLPGSAAT
  774-  797 (33.32/14.84)	QPKiDHLrRLHLGACPTEECKACT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      77.64|      26|      31|     636|     663|       7
---------------------------------------------------------------------------
  636-  663 (42.51/34.28)	LLRPG....HSFLRD.GTSLGMLRELMVviRIW
  665-  695 (35.13/21.54)	LLKPSclpvYTATSDtQDSMSLLFRLLT..KLW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.14|      18|      18|     342|     359|       8
---------------------------------------------------------------------------
  342-  359 (29.60/22.59)	LSATN.DLDRVSAVAL.PKL
  361-  380 (22.54/15.18)	ISLTNtDLKVASDTQFyPGL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28565 with Med16 domain of Kingdom Metazoa
Unable to open file!