<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28562
| Description |
Uncharacterized protein |
| Sequence | MSNSNAGRRSCDALPAAYARKMAASQQQASAASSAAGVSGPSSAGGPGTQQKSQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL |
| Length | 221 |
| Position | Tail |
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.399 |
| Instability index | 73.38 |
| Isoelectric point | 8.09 |
| Molecular weight | 23288.12 |
| Publications | PubMed=22002653
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28562
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.63| 19| 20| 40| 58| 1
---------------------------------------------------------------------------
40- 58 (36.42/18.85) GPSSAGGPGTQQKSQPPAQ
61- 79 (34.21/17.28) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|