<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28551
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 244 |
| Position | Head |
| Organism | Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Cercopithecinae> Macaca.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.029 |
| Instability index | 65.66 |
| Isoelectric point | 9.83 |
| Molecular weight | 26312.80 |
| Publications | PubMed=22002653
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28551
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 66.98| 16| 16| 14| 29| 1
---------------------------------------------------------------------------
14- 29 (36.98/11.02) PPP.....PPTALGFGPGKPP
44- 64 (30.00/ 7.65) PPPtaataPPGADKSGAGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 127.82| 32| 115| 99| 130| 2
---------------------------------------------------------------------------
67- 83 (21.56/ 6.47) ..........LMRELPGSTELTGSTN......L
99- 130 (58.86/28.32) KKVKEKLSN.FLPDLPGMIDLPGSHDNSSLRSL
215- 243 (47.40/21.60) KKEKKKKKNrHSPDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.86| 16| 18| 170| 185| 3
---------------------------------------------------------------------------
170- 185 (28.50/15.19) PPK...KKNKHKHKQSRTQ
189- 207 (21.35/ 9.64) PPEtpsDSDHKKKKKKKEE
---------------------------------------------------------------------------
|