Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MDSSQSPAAGGNGTLISHGNDAAASASGADDSMQNLSQISNSIEKTLGLIHQLSLTVSTFNSALQMPLLQRINGLVAELDNMVKLAEKCNIQVPMEVVNLIDDGKNPDEFTKDVINNCIAKNQITKGKTDALKDLRKHLLEELEQNFPDEVETFRENRAAAAAELKRLAQAPSVLPNGDARAKVEH |
Length | 186 |
Position | Middle |
Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago. |
Aromaticity | 0.02 |
Grand average of hydropathy | -0.378 |
Instability index | 32.31 |
Isoelectric point | 4.98 |
Molecular weight | 20044.33 |
Publications | PubMed=22089132 PubMed=24767513 PubMed=30397259 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP28534 No repeats found |
MoRF Sequence | Start | Stop |
1) LKRLAQA 2) LRKHLL | 165 135 | 171 140 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab