<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28529

Description U-box kinase family protein
SequenceMLKPMQIKNVMGAKFPASALTEQEVKAYREIESQNMQKTVDVYLAICQRMGVTATKLHIEMDCIEKGIIELISRYNIQNLVMGAASDKYHSRRMTDLRSKKAIYVCEQSPASCHIQFICKGYLIQTRDCSLENFRVEATSPLVQQMQNSEVGHSPHLISRSISHDQELHHHRVRSISSASESGRSMASSVSSSERFSSFETVLTPNLTSDGNESLLDLKMSYLSSIKEENLCHSSPPGVLDRGMDESVYDQLEQAIAEAVKARWDAYQETVKRRKAEKDVIDTIRKTKDTIILYEEEVKLRKELEEALQKAKEEIDNMKSKLDKVNKELQLALNHKSSKENQISEASRTHSLQLLSEFSFSEIEEATCNFNQSLKIGEGGYGKIFKGILRHTDVAIKVLSPNSTQGPSEFQQEVEVLSKLKHPNLITLIGVNQESKTLIYEYLPNGSLEDHLSRNGNNNAPPLTWQTRIRIATELCSALIFLHSNKPHSIVHGDLKPSNILLDANLVTKLSDFGICRVLSCQNDSSSNNSTTQFWITSFAKGTFAYMDPEFLGTGELTSKSDVYSFGIVLLRLITGKPALGIKNEVLYALNNAGGNVKSVLDPLAGDWPIVEAEKLVHFALRCCDMNKKSRPELCSEGWRVLEPMKVSCSGTNNFGLKSCLDKQLNRTT
Length669
PositionTail
OrganismMedicago truncatula (Barrel medic) (Medicago tribuloides)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
Aromaticity0.06
Grand average of hydropathy-0.393
Instability index46.14
Isoelectric point6.69
Molecular weight74950.57
Publications
PubMed=22089132
PubMed=24767513

Function

Annotated function
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein kinase activity	GO:0004672	IEA:InterPro
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP28529
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      70.38|      21|      21|     197|     217|       1
---------------------------------------------------------------------------
  197-  217 (33.87/22.02)	SSFETVLTPNLTSDGNESLLD
  221-  241 (36.51/24.33)	SYLSSIKEENLCHSSPPGVLD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.02|      22|      22|     288|     309|       2
---------------------------------------------------------------------------
  288-  309 (34.23/18.90)	KDTIILYEEEV.KLRKELEEALQ
  312-  334 (27.80/14.27)	KEEIDNMKSKLdKVNKELQLALN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     105.24|      30|      30|     586|     615|       3
---------------------------------------------------------------------------
  586-  615 (50.10/36.56)	VLYALNNAGGNVKSVLDPLAGDWPIVEAEK
  617-  646 (55.13/41.00)	VHFALRCCDMNKKSRPELCSEGWRVLEPMK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.82|      12|      30|     149|     163|       4
---------------------------------------------------------------------------
  149-  163 (15.98/18.33)	SEVGHSphlISRSIS
  180-  191 (20.84/11.93)	SESGRS...MASSVS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP28529 with Med32 domain of Kingdom Viridiplantae

Unable to open file!