<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28522
| Description |
Uncharacterized protein |
| Sequence | MGLSYWAIIRSGTVLKRYFTYFVNFEGLKGERAQANGSITTGMPQQEVESDMQPLENDATAAQQTASSAQSKYTRFWKGSLTELRQGQRVLITKLECSRSSSASKTLTTNWPSDMQIVRLISQERMTIHKQHARKEDLLVFRPVNPGRSLSHLKEKKLGAVIQLPSQTLLLFVSEKPNQLIGMFIPQVTYSR |
| Length | 192 |
| Position | Unknown |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.422 |
| Instability index | 40.40 |
| Isoelectric point | 9.95 |
| Molecular weight | 21738.72 |
| Publications | PubMed=22089132
PubMed=24767513
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
transcription regulator complex GO:0005667 IBA:GO_Central
|
| GO - Biological Function | |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP28522
No repeats found
|