<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28514
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MLQHQVVQSPARLGLTNPNSPLIPNPTPPKLPPLQTTNHHQDRHLATPSPALLSLLPPLPRAQALLQQMASLSTKLFEVSPNKSLWVSAFRGSLPTFLSSQGQPRSSASLDSSPSTTKEILSLFTNLQTQMFEAVSELQEVLDQKDAKQKIDQEICSKDSALLAFANKLKDAERVLDILVDDYSDYRSKTKRLKLGDGSEDVSLTTSTVSSQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFADLDIGLPKSAETTEKTIEAIIEPPPLQPVDANSLANLPGIQGLLPPNFTVPAGWKPGMPVQLPIDIPIKPPPGWKPGDPVALDSLSIPRIEEQQLHPHVPQPKLPEIIQVAPVNLDLGESDSSDYSSDDASTDDED |
| Length | 400 |
| Position | Middle |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.384 |
| Instability index | 62.13 |
| Isoelectric point | 4.86 |
| Molecular weight | 43439.62 |
| Publications | PubMed=22089132
PubMed=24767513
PubMed=30397259
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
RuleBase:RU364141
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP28514
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.72| 17| 39| 288| 326| 1
---------------------------------------------------------------------------
288- 326 (23.12/27.40) P...PLQPVdanslanlPgiqgllppnftvpaGWKPGMPVQL
327- 346 (33.60/ 8.58) PidiPIKPP........P..............GWKPGDPVAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.97| 16| 37| 56| 72| 5
---------------------------------------------------------------------------
56- 71 (29.21/15.16) LPPL......PRAQALLQQMAS
94- 115 (22.76/ 6.24) LPTFlssqgqPRSSASLDSSPS
---------------------------------------------------------------------------
|