<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28514

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMLQHQVVQSPARLGLTNPNSPLIPNPTPPKLPPLQTTNHHQDRHLATPSPALLSLLPPLPRAQALLQQMASLSTKLFEVSPNKSLWVSAFRGSLPTFLSSQGQPRSSASLDSSPSTTKEILSLFTNLQTQMFEAVSELQEVLDQKDAKQKIDQEICSKDSALLAFANKLKDAERVLDILVDDYSDYRSKTKRLKLGDGSEDVSLTTSTVSSQLKLSDILSYAHRISYTTFAPPEFGAGQAPLRGALPPAPQDEQMRASQLYNFADLDIGLPKSAETTEKTIEAIIEPPPLQPVDANSLANLPGIQGLLPPNFTVPAGWKPGMPVQLPIDIPIKPPPGWKPGDPVALDSLSIPRIEEQQLHPHVPQPKLPEIIQVAPVNLDLGESDSSDYSSDDASTDDED
Length400
PositionMiddle
OrganismMedicago truncatula (Barrel medic) (Medicago tribuloides)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
Aromaticity0.05
Grand average of hydropathy-0.384
Instability index62.13
Isoelectric point4.86
Molecular weight43439.62
Publications
PubMed=22089132
PubMed=24767513
PubMed=30397259

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IBA:GO_Central
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP28514
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      56.72|      17|      39|     288|     326|       1
---------------------------------------------------------------------------
  288-  326 (23.12/27.40)	P...PLQPVdanslanlPgiqgllppnftvpaGWKPGMPVQL
  327-  346 (33.60/ 8.58)	PidiPIKPP........P..............GWKPGDPVAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.97|      16|      37|      56|      72|       5
---------------------------------------------------------------------------
   56-   71 (29.21/15.16)	LPPL......PRAQALLQQMAS
   94-  115 (22.76/ 6.24)	LPTFlssqgqPRSSASLDSSPS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28514 with Med4 domain of Kingdom Viridiplantae


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) VQLPIDIPIKPPPGWKPGDPVALDSLSIPRIEEQQLHPHVPQPKLPEIIQVAPVNLDLGESDSSDYSSDDASTDDED
2) VVQSPARLGLTNPNSPLIPNPTPPKLPPLQTTNHHQDRHLATPSPALL
324
6
400
53










Molecular Recognition Features






MoRF SequenceStartStop




NANANA