<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28499
| Description |
Transcription elongation factor (TFIIS) family protein |
| Sequence | MDLDDFRSILHTAGVDVWMFIDTAISVAAQDNAGELKRRRDGIVERLYAASTEGIPMCQNCDGGQRLVTNDNQIKKENSPSLSPERQPRRGGASSPPTPQSEGNEDGEDEEIDPYGGLFDDEQKKILEIKELLEDPHQSEDTLMELLQNLVDIDITFQELKETDIGRNVNQLRKHPSSDVRRLVKLLVKKWKEIVDDWVKQNPQRGKSTLMADGDSPLQKTTPNGHNHQIPDFAYSPNPHNGSSGSDRNTSEAEPKPKPKSVPRKDPPPKPRPSPPVTAPTSAPQNRQREQKESNFDAERLAAARKRLQANYKEADNG |
| Length | 318 |
| Position | Unknown |
| Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.086 |
| Instability index | 54.12 |
| Isoelectric point | 5.35 |
| Molecular weight | 35593.01 |
| Publications | PubMed=22089132
PubMed=24767513
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | translation elongation factor activity GO:0003746 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28499
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 102.87| 30| 182| 75| 108| 1
---------------------------------------------------------------------------
75- 108 (50.39/27.50) KKENSPSLSPERQPRrggaSSPP......TPQSEGNEDGE
258- 293 (52.48/21.45) KPKSVPRKDPPPKPR....PSPPvtaptsAPQNRQREQKE
---------------------------------------------------------------------------
|