<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28483

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMAVEPALNSCIQAYVDSVLDLALSFFTRLRCYAKFCRTLASQAATAGNVSNQNMVASPAQNSTTPETSQGGENGTTISGGSTQMNAWVQEAIAKISSTSDGVSNLTPTSPIGGPSSLMPISINTETFPGTPAVRLIGDCHFLQRLCQLLFFCFFFKRSQLVLYMNGLRRTAETSLVRSDDGQTGRAGQIVHGSKGGEEPSLGHIRLGTGNSGQGYSFKEVKVIFQVLMDLCRRTSGLQHPLPVSQVGSNNIQVRLHYIEGNYTVLPEVLEASLATQVHNIPRPRGVDDTRLLLRKLELLPPAEVWHRLNMFGGPCTDPDDSPRPVRSNPLDSRSLESNNIDYGTNGLWPRKHRMIERDAAFALNTSLDIMGSRRDVITTSWKTGLEGVWYKCIRCMRQTSAFTSPASANIPNQNERESWWVSRWATNCPMCGGRWVRVV
Length439
PositionTail
OrganismMedicago truncatula (Barrel medic) (Medicago tribuloides)
KingdomViridiplantae
LineageEukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta> Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae> rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade> NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
Aromaticity0.07
Grand average of hydropathy-0.277
Instability index50.04
Isoelectric point8.83
Molecular weight48300.31
Publications
PubMed=22089132
PubMed=24767513

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IBA:GO_Central

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP28483
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     140.14|      39|      40|     343|     381|       1
---------------------------------------------------------------------------
  343-  381 (69.93/52.97)	GTNGLWPRKHRMIERDAAFALNTSLDI..MGSRRDVITTSW
  384-  424 (70.20/53.20)	GLEGVWYKCIRCMRQTSAFTSPASANIpnQNERESWWVSRW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     102.91|      31|      40|      38|      77|       2
---------------------------------------------------------------------------
   41-   71 (53.47/40.91)	SQAATAGNVSNQNMVA.....SPAQNSTTPETSQGG
   78-  113 (49.44/20.24)	SGGSTQMNAWVQEAIAkisstSDGVSNLTPTSPIGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      97.80|      23|      38|     275|     297|       3
---------------------------------------------------------------------------
  239-  259 (22.67/10.00)	...HPLPVSQvGSNNIQVRLHYIE
  275-  297 (39.46/22.41)	TQVHNIPRPR.GVDDTRLLLRKLE
  316-  336 (35.67/19.61)	TDPDDSPRP...VRSNPLDSRSLE
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP28483 with Med16 domain of Kingdom Viridiplantae

Unable to open file!