<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28481
Description |
Mediator of RNA polymerase II transcription subunit 16 |
Sequence | MAMQNMPRSRVAGVAGLLVRELELHSPAEDCHRLNMFGGPCTDLGDEGCRNDAPTPVTSNPLDSNGLWPRKRRMSERDAAFGLSTSVDLGAYLGIMGSRREIVTTLWKTGLEGVWYKWQTSSFASPDSTNPPIQNDRELDGSAAGLTPVQCVKEDGYELYSWLV |
Length | 164 |
Position | Tail |
Organism | Medicago truncatula (Barrel medic) (Medicago tribuloides) |
Kingdom | Viridiplantae |
Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Fabales> Fabaceae> Papilionoideae> 50 kb inversion clade>
NPAAA clade> Hologalegina> IRL clade> Trifolieae> Medicago.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.428 |
Instability index | 47.59 |
Isoelectric point | 5.02 |
Molecular weight | 18020.09 |
Publications | PubMed=22089132
PubMed=24767513
PubMed=30397259
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP28481
No repeats found
|