<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28459
| Description |
Uncharacterized protein |
| Sequence | MDRITQAQDAVDELGDIMRKSLLYLSTKSGFAQSNASIPVTVSLSTVDTAEVLAENRELLVDELVTKAKQLKILIASLPDPVMIDVSDDQLAALSTEAEQVNADFDGALRECGKPDVLITRKRLIGMQNKSSASWRMCSSG |
| Length | 141 |
| Position | Middle |
| Organism | Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Mixiomycetes>
Mixiales> Mixiaceae> Mixia.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.079 |
| Instability index | 22.87 |
| Isoelectric point | 4.63 |
| Molecular weight | 15285.28 |
| Publications | PubMed=21478649
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28459
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.03| 20| 99| 10| 29| 1
---------------------------------------------------------------------------
10- 29 (34.63/26.81) AVDELG..D..IMRKSLLYLSTKS
108- 131 (27.40/19.89) ALRECGkpDvlITRKRLIGMQNKS
---------------------------------------------------------------------------
|