<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28456

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMAGSLNGHAPAALAQEGSNAVPVKATTPPSASKAISGPQPKSAIPAHPVSANGTDAMAVAGPSSELTSKQEEDTPMTRDPTAELPIVGEDLCYLGRLMEGMATHVFKDLQNLVEVLPSKDARARPRAIIEFVLSARQQLIKLLVLLRWSEHTDGLQRAINVIAFLQDFGYEFKRTDQILTTLIEDESIAARVRKYDLTTAIDLLTTGSYRRLPKAISAYAEAEYLDDQTVLSVMERMTRKIRYRLAVATEIPDGMRVDKLDDGKVTLSVAGLFEVVLTLGPINLNEARENTADDEDIDQDGEEQRWYVLDVRWLYDVYNSSGEPIPLQAKGKAKDDLVDLTNIELARDCETTDDAAALQRLFEYLNRTALCHKLVVLHADAMALSRTPRGSGLASRLSQDRQQLVLEYWRDHSNARDSKKEISHSSIILSVDSNPSPTATSRLRKHLRSPDAPRLASLLRTEWRPDGPTVIPLTALEVLDGKGVDDLLKVATLHHARMILRQIMRELGEDVADDRIEDDRPALHIKLAGSAILLVSVDQQSGRVHLRAQGDVPVRLRTYIASDARTLTAESLANVKTIRSVIARSRRLAVEGAIDCLDWHKQPGSLLDPSDHDISGRSGCETVLIALPDLADYLLSIACDEQPEYRLLQTRPVSIEREISTGIRRVLQAAQYNDDEARETLALDHLASIYEQCRLRATTLCLQHQLHARALSYQVLTQSICVSIGALPYLRQDMIWPNMFISVRLSRQPGELTCIAFQVKLRAKPRTLTLDAVRGLGLTVALTSEHVALMITDELQGAITLGLKALIQLCEGRRA
Length815
PositionTail
OrganismMixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Mixiomycetes> Mixiales> Mixiaceae> Mixia.
Aromaticity0.04
Grand average of hydropathy-0.200
Instability index43.65
Isoelectric point5.77
Molecular weight90173.97
Publications
PubMed=21478649

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP28456
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.45|      25|     324|     353|     382|       1
---------------------------------------------------------------------------
  353-  382 (37.56/32.68)	DDAA....ALQRL.....feYLNRTALC..HKlvvLHADAM
  674-  711 (29.88/14.39)	DDEAretlALDHLasiyeqcRLRATTLClqHQ...LHARAL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.52|      18|     325|     177|     208|       2
---------------------------------------------------------------------------
  187-  204 (29.81/38.77)	SIAARVRKYDLTTAIDLL
  580-  597 (30.71/ 6.91)	SVIARSRRLAVEGAIDCL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.05|      14|     389|     243|     256|       5
---------------------------------------------------------------------------
  243-  256 (26.42/21.39)	YRL......AVATEIPDGMR
  645-  664 (18.63/12.46)	YRLlqtrpvSIEREISTGIR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28456 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MAGSLNGHAPAALAQEGSNAVPVKATTPPSASKAISGPQPKSAIPAHPVSANGTDAMAVAGPSSELTSKQEEDTPMTRDPTA
1
82










Molecular Recognition Features






MoRF SequenceStartStop




1) AALAQEGSNAVPVKATTPPSASK
11
33