<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28452
Description |
Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSSGEDGASIWTSSSSAAQIKALSGVEERLAHLLQLASELMTALAPVLDPSGKSKKTMEDRREEIKVKGNEYFATLNAIQTVIRLAIRRIRIERMPLRPLLSPQSVSIAGANAEVGVPAHARPPSDQEALRDKTLSLPLMRIERDVWRDLKELIKSDSLRALLQDVMTSGEIRSEDEEMLL |
Length | 181 |
Position | Head |
Organism | Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Mixiomycetes>
Mixiales> Mixiaceae> Mixia.
|
Aromaticity | 0.02 |
Grand average of hydropathy | -0.274 |
Instability index | 62.53 |
Isoelectric point | 5.82 |
Molecular weight | 20027.82 |
Publications | PubMed=21478649
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP28452
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.21| 21| 48| 80| 100| 1
---------------------------------------------------------------------------
80- 100 (36.74/24.77) QTVIR...LAIRRIRIERMPLRPL
127- 150 (32.48/21.14) QEALRdktLSLPLMRIERDVWRDL
---------------------------------------------------------------------------
|