<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28449
Description |
Uncharacterized protein |
Sequence | MILREWSLKTPSLEASVVSLSSRAQATCQDFSQNLIHLHGAHYDSTWSAQMNVYRFVQPGQANSNAKVMHAVSLSTTGDLLVSVHDPTRLAVDPTRATTSMVVEASAFKELVGGPLGARQAQAHPTGTLTGWQHRPRQLSLTGHVLLVNDMRVLVGYATSGDIAPLSYFILAEHLAIDLPADSRVLLDGLQAILPSQVHLLPPPGLPGQDGEPKVPSSAATKVAQALLALYRAKQAI |
Length | 237 |
Position | Head |
Organism | Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina> Mixiomycetes>
Mixiales> Mixiaceae> Mixia.
|
Aromaticity | 0.05 |
Grand average of hydropathy | 0.031 |
Instability index | 32.20 |
Isoelectric point | 7.17 |
Molecular weight | 25359.71 |
Publications | PubMed=21478649
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28449
No repeats found
|