<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28445

Description CBP/p300 homolog
SequenceMLALQQDPVKQKLVQQQLVLLLHAHKCSLRDKENNEFAARNQPLPHTTCRLPHCPTMKEVLIHMTNCNVGRLCHFAHCASSRQIIAHWKNCSREDCPVCTPLKRARDVPLIFSLPHLANLIGTKGNSYGSADGEVVHQIGVSTMSAGRITNGNISNLPPPNVPVRTKEWHRQVTNDLRNHIVGKLVKAICPAPEMMNDIRLKDLNAYARKVEKEVFETAIDRKNYYHLLAEKIYEIQKELQEKKNSRLNQGAAQSPLDEFARMRIDEGGHQLRTNQETETNRQNQSQQPLMDINVQLNAAKTEEELELVFAELMKNPQLFHA
Length322
PositionTail
OrganismCaenorhabditis elegans
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.04
Grand average of hydropathy-0.571
Instability index43.10
Isoelectric point8.76
Molecular weight36671.70
Publications
PubMed=9851916

Function

Annotated function 
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-KW

GO - Biological Function
metal ion binding	GO:0046872	IEA:UniProtKB-KW
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28445
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     104.26|      28|      63|      23|      53|       1
---------------------------------------------------------------------------
   23-   53 (48.53/39.20)	HAHKCSL.RDKENNEFA.........ARNQPLPHTtcrLPH
   63-   87 (33.34/17.66)	HMTNCNVgRLCHFAHCA.........SSRQIIAH.......
   89-  116 (22.39/10.26)	..KNCSR.ED.......cpvctplkrARDVPLIFS...LPH
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28445 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KKNSRLNQGAAQSPLDEFARMRIDEGGHQLRTNQETETNRQNQSQQPLMDINVQ
243
296










Molecular Recognition Features






MoRF SequenceStartStop




NANANA