<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28436
| Description |
Mediator of RNA polymerase II transcription subunit 26 (Fragment) |
| Sequence | IRNMVAVLEVISSLERYPITKEALEETRLGKLVNDVRKKTKNEELAKRAKKLLRSWQKLIEPVQQNEVALRGANGGAHNCRPEAGASVSKGVPDLKHRNDLQRLPGPRLDRLGSRKRRGDQRDLGHPGPPPKVSKACHDLLGPNSSPLPTNGISGSPESFSSPLDGSGLMGSEGSRLEAVENDQLSGKVPVNAVRPHPSSPGLGQPPGPCLQAKVEETSGPPHPRAPSRCSFSPRNSRHEGSFARQRSPYTPKGSVPSPSPRPLVLEATQVPSPPPLDQPPRAGFSPDSSKADSDAASSGGSDSRKKKRYRPRDYTVNLDGQVAEAGVKPVRLKERKLTFDPMTRQIKPLTQKEPMRADSPVHTEQPPRTELDKQEAKASLQSPFEQTNWKELSRNEIIQSYLSRQSSLLSSSGAQTPGAHPFMAEYLRQEESTRRGARQPHVLVPHAPPADLPGLSREVTQGDLDRLQADQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNVLPYVCLD |
| Length | 513 |
| Position | Unknown |
| Organism | Heterocephalus glaber (Naked mole rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae>
Heterocephalus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.889 |
| Instability index | 59.43 |
| Isoelectric point | 9.37 |
| Molecular weight | 56154.34 |
| Publications | PubMed=21993625
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28436
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
5| 142.66| 23| 24| 287| 309| 1
---------------------------------------------------------------------------
131- 154 (27.47/ 8.46) PK..VS.KACHDLLGPNSSPlPTNGIS
157- 179 (26.11/ 7.67) PE..SF.SSPLDGSGLMGSE.GSRLEA
182- 206 (28.50/ 9.04) NDqlSG.KVPVNAVRPHPSS.PGLGQP
207- 229 (27.79/ 8.64) PG..PClQAKVE.ETSGPPH.PRAPSR
287- 309 (32.79/11.51) PD..SS.KADSDAASSGGSD.SRKKKR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.75| 23| 84| 259| 282| 2
---------------------------------------------------------------------------
233- 258 (32.16/ 9.41) SPRNSRHEGSfaRQRSPyTPKGSVPS
260- 282 (43.63/20.73) SPRPLVLEAT..QVPSP.PPLDQPPR
354- 369 (23.96/ 6.84) .......EPM..RADSP.VHTEQPPR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.66| 12| 21| 96| 107| 3
---------------------------------------------------------------------------
96- 107 (24.77/10.40) KHRNDLQRL..PGP
116- 129 (19.88/ 7.15) KRRGDQRDLghPGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.15| 15| 22| 402| 418| 5
---------------------------------------------------------------------------
402- 418 (21.71/15.49) YLSRQSSllSSSGAQTP
427- 441 (27.44/13.91) YLRQEES..TRRGARQP
---------------------------------------------------------------------------
|