<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28432
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MDVSGQETDWRSAAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDILELPAGQSWFSSSWTICMFSQRISRLSYAVGFVEAIPLLTVIAGVVRAPMVVQQPQVQPQVQQQPAVQTAQAAQMVASGVQVSQSGLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVLPTKQQDLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSLAAA |
| Length | 513 |
| Position | Tail |
| Organism | Heterocephalus glaber (Naked mole rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae>
Heterocephalus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.353 |
| Instability index | 77.17 |
| Isoelectric point | 8.96 |
| Molecular weight | 56420.12 |
| Publications | PubMed=21993625
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28432
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 142.88| 28| 28| 173| 200| 1
---------------------------------------------------------------------------
127- 160 (24.94/ 6.13) QPQV..QQQPAVQtaqaaqmVASGVQVSQ.SgltM.....LS
161- 180 (37.44/13.21) SPSP..GQQ................VQTPqS...MP.PPPQP
181- 211 (45.51/17.78) SPQP..GSQPNSN.......VSSGPAPSPsS..fLPsPSPQP
212- 240 (34.98/11.82) SQSPvtARTP.QN.......FSV.PSPGPlN...TP.VNPSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.66| 21| 23| 282| 304| 2
---------------------------------------------------------------------------
284- 304 (37.42/27.06) KDLSKMKSLLDILTD....PSKRCP
306- 330 (31.24/14.57) KTLQKCEIALEKLKNdmavPTPPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.21| 14| 22| 405| 418| 3
---------------------------------------------------------------------------
405- 418 (24.63/12.84) VARLDPKFLVNLDP
430- 443 (26.58/14.40) ICKLDDKDLPSVPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.91| 13| 22| 343| 356| 4
---------------------------------------------------------------------------
106- 118 (22.45/ 8.32) PLLTVIAGVVRAP
343- 355 (21.46/ 7.50) PLLDAVLANIRSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 78.33| 23| 378| 71| 94| 5
---------------------------------------------------------------------------
71- 94 (41.20/33.07) ELPAgQS..WFSSSW..TICMFSQRISR
451- 477 (37.13/23.95) DYPA.QSplWIDRQWqyDANPFLQSVHR
---------------------------------------------------------------------------
|