<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28432

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMDVSGQETDWRSAAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDILELPAGQSWFSSSWTICMFSQRISRLSYAVGFVEAIPLLTVIAGVVRAPMVVQQPQVQPQVQQQPAVQTAQAAQMVASGVQVSQSGLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVLPTKQQDLCQPLLDAVLANIRSPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRFEEDERQSIPNVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSIHQACLSLAAA
Length513
PositionTail
OrganismHeterocephalus glaber (Naked mole rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae> Heterocephalus.
Aromaticity0.05
Grand average of hydropathy-0.353
Instability index77.17
Isoelectric point8.96
Molecular weight56420.12
Publications
PubMed=21993625

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364148
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP28432
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     142.88|      28|      28|     173|     200|       1
---------------------------------------------------------------------------
  127-  160 (24.94/ 6.13)	QPQV..QQQPAVQtaqaaqmVASGVQVSQ.SgltM.....LS
  161-  180 (37.44/13.21)	SPSP..GQQ................VQTPqS...MP.PPPQP
  181-  211 (45.51/17.78)	SPQP..GSQPNSN.......VSSGPAPSPsS..fLPsPSPQP
  212-  240 (34.98/11.82)	SQSPvtARTP.QN.......FSV.PSPGPlN...TP.VNPSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.66|      21|      23|     282|     304|       2
---------------------------------------------------------------------------
  284-  304 (37.42/27.06)	KDLSKMKSLLDILTD....PSKRCP
  306-  330 (31.24/14.57)	KTLQKCEIALEKLKNdmavPTPPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.21|      14|      22|     405|     418|       3
---------------------------------------------------------------------------
  405-  418 (24.63/12.84)	VARLDPKFLVNLDP
  430-  443 (26.58/14.40)	ICKLDDKDLPSVPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.91|      13|      22|     343|     356|       4
---------------------------------------------------------------------------
  106-  118 (22.45/ 8.32)	PLLTVIAGVVRAP
  343-  355 (21.46/ 7.50)	PLLDAVLANIRSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.33|      23|     378|      71|      94|       5
---------------------------------------------------------------------------
   71-   94 (41.20/33.07)	ELPAgQS..WFSSSW..TICMFSQRISR
  451-  477 (37.13/23.95)	DYPA.QSplWIDRQWqyDANPFLQSVHR
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28432 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) QSGLTMLSSPSPGQQVQTPQSMPPPPQPSPQPGSQPNSNVSSGPAPSPSSFLPSPSPQPSQSPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQ
153
261










Molecular Recognition Features






MoRF SequenceStartStop




NANANA