<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28431
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MVVQQLQVQPQVQQQPAVQTAEAAQMLASGVQVSQSSLTMLSSSSPGQQVQTPQSKPTPSQSPVTACTAQNFSVPSPGPLNIPVNPSSVMSLASSSQVEEQQYLDKPKQLSKYIEPLHHMINMNEDRIKDLSKMKSLLDTLTGPSKQCSLKTLQKCENALEKIKNDMAVPTPALPPVLPTKHQDLCQLLLDSVLANIHSPVFNDSRYRTFVLAMKAIHSPPIEATVVWTQKCRFEEDEQQSILNVLQGEVGRLAPKFLVNLDPSHCSNNGTFHLICKLDDKNLPSVPPLELSMPADYPAQSLLWINWQWQYDTNPFLQSVHQCITCRMLQLPDKYSVTTLLNTWAQSIHQACLLAGMAGTTNTLVRSVDTHLILDLSRCWLP |
| Length | 382 |
| Position | Tail |
| Organism | Heterocephalus glaber (Naked mole rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae>
Heterocephalus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.231 |
| Instability index | 65.66 |
| Isoelectric point | 6.35 |
| Molecular weight | 42363.26 |
| Publications | PubMed=21993625
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28431
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 110.12| 34| 112| 35| 72| 1
---------------------------------------------------------------------------
3- 24 (27.12/ 7.36) ...............VQQLQVQPQVQQQPAVQ.TAEAA
35- 72 (50.13/29.80) QSSLTMLSSSSpgqQVQTPQSKPTPSQSPVTAcTAQNF
86- 109 (32.87/10.73) PSSVMSLASSS...QVEEQQYLDKPKQ...........
---------------------------------------------------------------------------
|