<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28427

Description Mediator of RNA polymerase II transcription subunit 24
SequenceMKVVNLKQAILQAWKERWSDYQWAINMKKFFPKGATWDILNLAEALLEQAMIGPSPNPLILSYLKYAISSQMVSYSSVLTAISKFDDFSRDLCVQALLDIMDMFCDRLREPKALGNVREGRVSASGAWTDSPPLLQLSRQSRGVHRAVPGPPQRPPLAGAGPSFERLQEAPEATSPGTSEKQLAMCLQRLEKTLSSSKNRALLHIAKLEEASSWTAIEQCLLKLGETLANLSSPQLRSQAEQCGVLIRSIPTMLSVHSERLHETGFPTVHAVVLLEGTMNLTGETQPLVEQLMMVKRMQHIPTPLFVLEIWKACFVGLIESPEGTEELKWTAFTYLKIPQVLVKLKKYSHGDRDFTEDVNCAFEFFFLKLTPLLDKADQRCNCDCTNFLLQECNKQGLLSEASFASLMAKCKSDREQAPQLKSSENANIQPNPGLILRAEPTVTNILKTMDADHSKSPEGLLGVLGHMLSGKSLDLLLAAAAATGKLKSFARKFINLNEFTTHGPGESTKTASVRALLFDISFLMLCHVAQTYGSEVILSEASSGAEVPFFETWMQTCMPEEGKILNPDHPCFRPDSTKVEQMKWHEACLSISAAILEILNAWENGVLAFESIQKITDNIKGKVCSLAVCAVAWLVAHVRMLGLDEREKSLQMIRQLAGPLYSENTLQFYNERVVIMNSILEHMCADVLQQTATQIKFPSTGVDTMPYWNLLPPKRPIKEVLTGVFAEVLEKGWVDSRSVHILDTLLHMGGVYWFCSNLLKELLKETRKEHTLRAVELLYSIFCLDMQQVTLVLLGHILPGLLTDSSKWHSLMDPPGTALAKLAVWCALSAYSSHKGQASSRQKKRHREDIEDYTSLFPLDDTQPSKLMRLLSSNEDDANILSSPTDRSMSSSLSASQLHTVNMRDPLNRVLVLLPQPPESWESRRAPPRLPSFAWSPAWPHLAPPEPLLPPRSQLVPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGSRGSILQFMPFTTVSELVKVSSMSSPKVVLAITDLSLPLGRQVAAKAIAAL
Length1042
PositionTail
OrganismHeterocephalus glaber (Naked mole rat)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae> Heterocephalus.
Aromaticity0.07
Grand average of hydropathy-0.085
Instability index51.91
Isoelectric point6.79
Molecular weight112366.98
Publications
PubMed=21993625

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP28427
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     116.38|      36|      38|     738|     773|       1
---------------------------------------------------------------------------
  738-  773 (64.10/41.61)	RSVHILDTL..LHMGGV.YWFCSNLLKELLKETRKEHTL
  774-  812 (52.29/32.60)	RAVELLYSIfcLDMQQVtLVLLGHILPGLLTDSSKWHSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.32|      14|      29|     554|     567|       2
---------------------------------------------------------------------------
  554-  567 (28.26/21.62)	WMQTCMPEEGKILN
  585-  598 (25.06/18.16)	WHEACLSISAAILE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      77.20|      16|     587|     136|     155|       3
---------------------------------------------------------------------------
  132-  147 (25.79/ 6.37)	PPLLQLSRQSRGVHRA
  152-  166 (20.77/11.88)	PQRPPLAGAGPSFER.
  928-  943 (30.64/ 9.80)	PPRLPSFAWSPAWPHL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.90|      23|      31|     333|     355|       6
---------------------------------------------------------------------------
  333-  355 (40.57/29.54)	FTYLKIPQVLVKLKKYSHGD.RDF
  365-  388 (38.33/27.47)	FFFLKLTPLLDKADQRCNCDcTNF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28427 with Med24 domain of Kingdom Metazoa
Unable to open file!