<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28422
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGAQADPPPPPTALSFGPGKPPPPPPPPPGGGPGTAAPPTAATAPPGADKSTAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLSGFRLHTGPLPEQCRLMHIQPPRKSKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKSRHSPDHPGMGSSQASSSSSLR |
| Length | 243 |
| Position | Head |
| Organism | Heterocephalus glaber (Naked mole rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae>
Heterocephalus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.994 |
| Instability index | 63.88 |
| Isoelectric point | 9.82 |
| Molecular weight | 26162.58 |
| Publications | PubMed=21993625
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28422
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.25| 16| 16| 14| 29| 1
---------------------------------------------------------------------------
14- 29 (36.29/10.12) PPPPPTALSFGPGKPP
31- 46 (36.96/10.42) PPPPPPGGGPGTAAPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 63.85| 18| 18| 162| 179| 2
---------------------------------------------------------------------------
162- 179 (36.50/17.49) QCRLMHIQPPR...KSKHKHK
180- 200 (27.36/11.53) QSRTQDPVPPEtpsDSDHKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 161.82| 41| 113| 90| 130| 3
---------------------------------------------------------------------------
67- 89 (25.61/ 7.80) ..................LMRELPGSTELTGSTNLITHYNL
90- 130 (74.47/33.60) EQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSL
206- 242 (61.74/26.88) EDPERKRKKKEKKKKKSRHSPDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
|