<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28419
| Description |
Mediator of RNA polymerase II transcription subunit 29 |
| Sequence | MAAPQQQASAASSAAGVSGPGSAGGPGPQQQQQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNVDNGQKSSDVPLQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQIACAKDIHTALLECANKVTGKMPTPPTGPGGTL |
| Length | 200 |
| Position | Tail |
| Organism | Heterocephalus glaber (Naked mole rat) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Glires> Rodentia> Hystricomorpha> Bathyergidae>
Heterocephalus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.358 |
| Instability index | 71.09 |
| Isoelectric point | 5.87 |
| Molecular weight | 21199.89 |
| Publications | PubMed=21993625
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28419
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.86| 21| 46| 52| 72| 3
---------------------------------------------------------------------------
52- 72 (37.45/25.26) QDFDP.VQRYKMLIPQLKESLQ
100- 121 (33.41/21.85) QRFDKcLEEFYALCDQLELCLR
---------------------------------------------------------------------------
|