Description | Uncharacterized protein |
Sequence | MSGGAGGDVDRALSSIRARADHLRHTVARLEHNLAWNPASTWPELLSQYMVISKQLENMNEEIPDLVQHFACVPRMSTPNPADIPLLLRTREDPEMEEEDRQLMADKPREKNTEALQKLVMAHNDSVESLEETFNEMSDGLLKAIRVNKYVVKSKPQSTQSQQFKYIESGTYE |
Length | 173 |
Position | Head |
Organism | Phytophthora sojae (strain P6497) (Soybean stem and root rot agent) (Phytophthora megasperma f. sp. glycines) |
Kingdom | Oomycetes |
Lineage | Eukaryota> Sar> Stramenopiles> Oomycota> Peronosporales> Peronosporaceae> Phytophthora. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.698 |
Instability index | 57.55 |
Isoelectric point | 5.19 |
Molecular weight | 19708.98 |
Publications | PubMed=16946064 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28398 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 101.77| 32| 34| 74| 106| 1 --------------------------------------------------------------------------- 74- 106 (51.08/35.76) PRMSTPNPADiPLLLRTREDPEMEEEDRQLMAD 108- 139 (50.69/31.03) PREKNTEALQ.KLVMAHNDSVESLEETFNEMSD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IPLLLRTRE 2) QQFKYIESGTY | 84 162 | 92 172 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab