<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28393
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MQSRSRPQNNLKNFGLDESRNRFQIELEFVQCLANPSYLNFLAQQGWFEKPNFIKYLKYLLYWKDPAYSRYLIYPYCLHLLDLLQHAEFRSALARGQICRMIDDQILLHWQHYMRKRAALIAKHVEETIQPT |
Length | 132 |
Position | Middle |
Organism | Schistosoma mansoni (Blood fluke) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.14 |
Grand average of hydropathy | -0.448 |
Instability index | 50.47 |
Isoelectric point | 9.19 |
Molecular weight | 15982.31 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28393
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 58.70| 16| 28| 27| 42| 1
---------------------------------------------------------------------------
27- 42 (28.64/19.60) LEFVQCLANPSYLNFL
57- 72 (30.06/20.90) LKYLLYWKDPAYSRYL
---------------------------------------------------------------------------
|