<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28387

Description Mediator of RNA polymerase II transcription subunit 19
SequenceMNPSPAFSAANGTGSNLQTGNTVSATWINKLKIVGRGQNWAVAPCEPFYLMGTEPPAPDAALTGAKNLIEHYGLENAYQKFCGKRLREELNAFLPHLSGNIDVPASVDESGLMSLIERPPIRGKELRPFAPSQLDHAFRLHPGPLPQEYASLFAAAPSKHIHRSVQDQQQLMGSNGTGTRVPATAVPGLSSSGSFHRRRRRHEVHRGALASGSDSSSSIGVPGVGGVGSGNVSASPASFFTGAPTAYPQLGAVHTTASLSSKSMVSQSHTLSSSLSITTSAPCTNVTMSNQSSNALDNNPVTQVVNHSKLVDHPPGLIPVSAPHSHLLGSSISTSSSSSEPPPPPLLAPIHHHSNQKLPHSIQNTSSTLNPLYNSNTIDVSLTPNKSVPPAPPVLHSIHPPSINPINSSVPSQPPSHQFHHYRHQQQQQLSSHLHHHQHPLSSVHHHHPIASSHSYPSSLSQNSSRSMSPIPMETNSSSPQSPDIYKIRRLDMTDEERRKKKRREKKRRKDKE
Length513
PositionHead
OrganismSchistosoma mansoni (Blood fluke)
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
Aromaticity0.04
Grand average of hydropathy-0.603
Instability index68.89
Isoelectric point9.77
Molecular weight55186.96
Publications
PubMed=22253936

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP28387
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     153.06|      32|      33|     355|     386|       1
---------------------------------------------------------------------------
  236-  263 (28.04/ 6.88)	....PASFFTGAPTAYPQLGAVHTTA.SLSSKS
  355-  386 (52.73/18.87)	NQKLPHSIQNTSSTLNPLYNSNTIDV.SLTPNK
  396-  417 (28.62/ 7.16)	.....HSIHPPS..INPI.NSS...VpSQPPSH
  427-  454 (43.67/14.47)	QQQLSSHLHHHQHPLSSVHHHHPIAS.S....H
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.63|      21|     155|      14|      35|       2
---------------------------------------------------------------------------
   14-   35 (34.25/21.21)	GSNlQTGNTVSATWINKLKIVG
  173-  193 (38.38/20.01)	GSN.GTGTRVPATAVPGLSSSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.46|      11|      16|     207|     217|       4
---------------------------------------------------------------------------
  207-  217 (18.74/10.31)	GALASGSDSSS
  225-  235 (19.73/11.25)	GGVGSGNVSAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.24|      10|      54|     267|     276|      12
---------------------------------------------------------------------------
  267-  276 (18.46/ 9.59)	QSHTLSSSLS
  324-  333 (18.77/ 9.90)	HSHLLGSSIS
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP28387 with Med19 domain of Kingdom Metazoa

Unable to open file!