<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28387
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MNPSPAFSAANGTGSNLQTGNTVSATWINKLKIVGRGQNWAVAPCEPFYLMGTEPPAPDAALTGAKNLIEHYGLENAYQKFCGKRLREELNAFLPHLSGNIDVPASVDESGLMSLIERPPIRGKELRPFAPSQLDHAFRLHPGPLPQEYASLFAAAPSKHIHRSVQDQQQLMGSNGTGTRVPATAVPGLSSSGSFHRRRRRHEVHRGALASGSDSSSSIGVPGVGGVGSGNVSASPASFFTGAPTAYPQLGAVHTTASLSSKSMVSQSHTLSSSLSITTSAPCTNVTMSNQSSNALDNNPVTQVVNHSKLVDHPPGLIPVSAPHSHLLGSSISTSSSSSEPPPPPLLAPIHHHSNQKLPHSIQNTSSTLNPLYNSNTIDVSLTPNKSVPPAPPVLHSIHPPSINPINSSVPSQPPSHQFHHYRHQQQQQLSSHLHHHQHPLSSVHHHHPIASSHSYPSSLSQNSSRSMSPIPMETNSSSPQSPDIYKIRRLDMTDEERRKKKRREKKRRKDKE |
| Length | 513 |
| Position | Head |
| Organism | Schistosoma mansoni (Blood fluke) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.603 |
| Instability index | 68.89 |
| Isoelectric point | 9.77 |
| Molecular weight | 55186.96 |
| Publications | PubMed=22253936
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28387
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 153.06| 32| 33| 355| 386| 1
---------------------------------------------------------------------------
236- 263 (28.04/ 6.88) ....PASFFTGAPTAYPQLGAVHTTA.SLSSKS
355- 386 (52.73/18.87) NQKLPHSIQNTSSTLNPLYNSNTIDV.SLTPNK
396- 417 (28.62/ 7.16) .....HSIHPPS..INPI.NSS...VpSQPPSH
427- 454 (43.67/14.47) QQQLSSHLHHHQHPLSSVHHHHPIAS.S....H
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.63| 21| 155| 14| 35| 2
---------------------------------------------------------------------------
14- 35 (34.25/21.21) GSNlQTGNTVSATWINKLKIVG
173- 193 (38.38/20.01) GSN.GTGTRVPATAVPGLSSSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.46| 11| 16| 207| 217| 4
---------------------------------------------------------------------------
207- 217 (18.74/10.31) GALASGSDSSS
225- 235 (19.73/11.25) GGVGSGNVSAS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.24| 10| 54| 267| 276| 12
---------------------------------------------------------------------------
267- 276 (18.46/ 9.59) QSHTLSSSLS
324- 333 (18.77/ 9.90) HSHLLGSSIS
---------------------------------------------------------------------------
|