Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MNPSPAFSAANGTGSNLQTGNTVSATWINKLKIVGRGQNWAVAPCEPFYLMGTEPPAPDAALTGAKNLIEHYGLENAYQKFCGKRLREELNAFLPHLSGNIDVPASVDESGLMSLIERPPIRGKELRPFAPSQLDHAFRLHPGPLPQEYASLFAAAPSKHIHRSVQDQQQLMGSNGTGTRVPATAVPGLSSSGSFHRRRRRHEVHRGALASGSDSSSSIGVPGVGGVGSGNVSASPASFFTGAPTAYPQLGAVHTTASLSSKSMVSQSHTLSSSLSITTSAPCTNVTMSNQSSNALDNNPVTQVVNHSKLVDHPPGLIPVSAPHSHLLGSSISTSSSSSEPPPPPLLAPIHHHSNQKLPHSIQNTSSTLNPLYNSNTIDVSLTPNKSVPPAPPVLHSIHPPSINPINSSVPSQPPSHQFHHYRHQQQQQLSSHLHHHQHPLSSVHHHHPIASSHSYPSSLSQNSSRSMSPIPMETNSSSPQSPDIYKIRRLDMTDEERRKKKRREKKRRKDKE |
Length | 513 |
Position | Head |
Organism | Schistosoma mansoni (Blood fluke) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.603 |
Instability index | 68.89 |
Isoelectric point | 9.77 |
Molecular weight | 55186.96 |
Publications | PubMed=22253936 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP28387 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 4| 153.06| 32| 33| 355| 386| 1 --------------------------------------------------------------------------- 236- 263 (28.04/ 6.88) ....PASFFTGAPTAYPQLGAVHTTA.SLSSKS 355- 386 (52.73/18.87) NQKLPHSIQNTSSTLNPLYNSNTIDV.SLTPNK 396- 417 (28.62/ 7.16) .....HSIHPPS..INPI.NSS...VpSQPPSH 427- 454 (43.67/14.47) QQQLSSHLHHHQHPLSSVHHHHPIAS.S....H --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.63| 21| 155| 14| 35| 2 --------------------------------------------------------------------------- 14- 35 (34.25/21.21) GSNlQTGNTVSATWINKLKIVG 173- 193 (38.38/20.01) GSN.GTGTRVPATAVPGLSSSG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 38.46| 11| 16| 207| 217| 4 --------------------------------------------------------------------------- 207- 217 (18.74/10.31) GALASGSDSSS 225- 235 (19.73/11.25) GGVGSGNVSAS --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 37.24| 10| 54| 267| 276| 12 --------------------------------------------------------------------------- 267- 276 (18.46/ 9.59) QSHTLSSSLS 324- 333 (18.77/ 9.90) HSHLLGSSIS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FHHYRH 2) PQSPDIYKIRRLDMTDEERRKKKRREKKRRK | 419 480 | 424 510 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab