<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28386
Description |
Putative mediator of RNA polymerase II transcription subunit 28 (Mediator complex subunit 28) (Tumor angiogenesis marker EG-1) (Endothelial-derived protein 1) (Merlin and Grb2-interacting cytoskeletal... |
Sequence | MDPDAKVLSDLETQLDNIFMVLSSTGLHDSDISESQHGLNDKHMASLLDACRQMDSWFIKKRLALSTYYQEYALKEEIDALNAECIRKEKLAQELKGRIEDYSKSIQVIIDQSKGNQIIPGYSAYEYLNEPKKRMLNGLRFQELLRLQKLKDSAKWLEDLGKRSFIYGVDSLADDEYD |
Length | 178 |
Position | Head |
Organism | Schistosoma mansoni (Blood fluke) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.589 |
Instability index | 45.95 |
Isoelectric point | 4.99 |
Molecular weight | 20563.05 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP28386
No repeats found
|