<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28386
| Description |
Putative mediator of RNA polymerase II transcription subunit 28 (Mediator complex subunit 28) (Tumor angiogenesis marker EG-1) (Endothelial-derived protein 1) (Merlin and Grb2-interacting cytoskeletal... |
| Sequence | MDPDAKVLSDLETQLDNIFMVLSSTGLHDSDISESQHGLNDKHMASLLDACRQMDSWFIKKRLALSTYYQEYALKEEIDALNAECIRKEKLAQELKGRIEDYSKSIQVIIDQSKGNQIIPGYSAYEYLNEPKKRMLNGLRFQELLRLQKLKDSAKWLEDLGKRSFIYGVDSLADDEYD |
| Length | 178 |
| Position | Head |
| Organism | Schistosoma mansoni (Blood fluke) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.589 |
| Instability index | 45.95 |
| Isoelectric point | 4.99 |
| Molecular weight | 20563.05 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP28386
No repeats found
|