<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28381

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMSSRVSLKQKLIGQLEDADSLLRDILSAASKKKSVTLFPLIELLLEKDQQLKETYKEIEVYNEIQKKIDLLKADCSKSDKQIQSCQLHLKKTEVILSTALYYSRQKLDSMTTAVKNPIDMEELVRFSHRISATHGVIAPDNWTQGDPRRPYPNKEEIRRGYLGHIDDAGNFRQSLWDALSDTAAAAASIVVSSTPSVSSNSCPNSLSNANIGTSQTPVYHSNQTQPTSLSLVTCSPNMILPGVNMVSSPMSFSQSGGSSTWTGPNMNLITGNPPSSELAGSQTSASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPSLKQGSGQMQASQVTSFRPSGVLPRPLNSGNRQAFPSSPNSSGSQHMQCPHSDTHPSFMPSSKTSRPHSKRAHRKHTDTECTEMSSNSSSDSSSGEE
Length412
PositionMiddle
OrganismSchistosoma mansoni (Blood fluke)
KingdomMetazoa
LineageEukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda> Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
Aromaticity0.04
Grand average of hydropathy-0.613
Instability index60.19
Isoelectric point8.64
Molecular weight44691.47
Publications
PubMed=22253936

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP28381
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      94.37|      21|      21|     187|     207|       1
---------------------------------------------------------------------------
  187-  207 (37.72/15.99)	ASIVVSS....TPSVSSN.SCPNSLS
  209-  230 (33.54/13.56)	ANIGTSQ....TPVYHSNqTQPTSLS
  231-  253 (23.12/ 7.52)	..LVTCSpnmiLPGVNMV.SSPMSFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      88.01|      20|      22|     350|     369|       2
---------------------------------------------------------------------------
  273-  292 (22.06/ 6.52)	..PPSSEL.AGSQtSASRPPSTS
  350-  369 (40.61/17.81)	F.PSSPNS.SGSQ.HMQCPHSDT
  373-  394 (25.34/ 8.52)	FmPSSKTSrPHSK.RAHRKHTDT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.80|      12|      25|     312|     326|       3
---------------------------------------------------------------------------
  312-  326 (20.07/18.29)	LPPPslkQGSGQMQA
  338-  349 (23.72/12.88)	LPRP...LNSGNRQA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP28381 with Med4 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MVSSPMSFSQSGGSSTWTGPNMNLITGNPPSSELAGSQTSASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPSLKQGSGQMQASQVTSFRPSGVLPRPLNSGNRQAFPSSPNSSGSQHMQCPHSDTHPSFMPSSKTSRPHSKRAHRKHTDTECTEMSSNSSSDSSSGEE
245
412










Molecular Recognition Features






MoRF SequenceStartStop




NANANA