<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP28381
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MSSRVSLKQKLIGQLEDADSLLRDILSAASKKKSVTLFPLIELLLEKDQQLKETYKEIEVYNEIQKKIDLLKADCSKSDKQIQSCQLHLKKTEVILSTALYYSRQKLDSMTTAVKNPIDMEELVRFSHRISATHGVIAPDNWTQGDPRRPYPNKEEIRRGYLGHIDDAGNFRQSLWDALSDTAAAAASIVVSSTPSVSSNSCPNSLSNANIGTSQTPVYHSNQTQPTSLSLVTCSPNMILPGVNMVSSPMSFSQSGGSSTWTGPNMNLITGNPPSSELAGSQTSASRPPSTSLAAMLTGTNIMDQHSRNTTLPPPSLKQGSGQMQASQVTSFRPSGVLPRPLNSGNRQAFPSSPNSSGSQHMQCPHSDTHPSFMPSSKTSRPHSKRAHRKHTDTECTEMSSNSSSDSSSGEE |
| Length | 412 |
| Position | Middle |
| Organism | Schistosoma mansoni (Blood fluke) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Spiralia> Lophotrochozoa> Platyhelminthes> Trematoda>
Digenea> Strigeidida> Schistosomatoidea> Schistosomatidae> Schistosoma.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.613 |
| Instability index | 60.19 |
| Isoelectric point | 8.64 |
| Molecular weight | 44691.47 |
| Publications | PubMed=22253936
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP28381
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 94.37| 21| 21| 187| 207| 1
---------------------------------------------------------------------------
187- 207 (37.72/15.99) ASIVVSS....TPSVSSN.SCPNSLS
209- 230 (33.54/13.56) ANIGTSQ....TPVYHSNqTQPTSLS
231- 253 (23.12/ 7.52) ..LVTCSpnmiLPGVNMV.SSPMSFS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.01| 20| 22| 350| 369| 2
---------------------------------------------------------------------------
273- 292 (22.06/ 6.52) ..PPSSEL.AGSQtSASRPPSTS
350- 369 (40.61/17.81) F.PSSPNS.SGSQ.HMQCPHSDT
373- 394 (25.34/ 8.52) FmPSSKTSrPHSK.RAHRKHTDT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.80| 12| 25| 312| 326| 3
---------------------------------------------------------------------------
312- 326 (20.07/18.29) LPPPslkQGSGQMQA
338- 349 (23.72/12.88) LPRP...LNSGNRQA
---------------------------------------------------------------------------
|